TXN2 Protein, Human

As a monomer, the TXN2 protein is critical for maintaining mitochondrial reactive oxygen species (ROS) homeostasis, regulating apoptosis, and ensuring cell viability.Its unique dithiol reducing activity fine-tunes cellular redox balance, making a significant contribution to overall cellular health.TXN2 Protein, Human is the recombinant human-derived TXN2 protein, expressed by E.coli , with tag free.

The TXN2 protein plays a crucial role in maintaining the delicate balance of mitochondrial reactive oxygen species (ROS) homeostasis, governing apoptosis regulation, and ensuring cell viability. Its distinctive dithiol-reducing activity emphasizes its ability to finely tune redox equilibrium within the cellular environment, contributing significantly to overall cellular health. Operating as a monomer, TXN2 emerges as a central figure in essential cellular processes, underscoring its importance in safeguarding mitochondrial function and promoting sustained cell viability.

Human

E. coli

Tag Free

Q99757 (T60-G166)

25828  [NCBI]

Full Length of Mature Protein

TTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG

Approximately 13 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.