TSPAN31 Protein, Human (HEK293, Fc)

TSPAN31 is a member of the tetraspanin protein family, which has four hydrophobic domains. TSPAN31 mediates signal transduction events and plays a role in the regulation of cell development, activation, growth, and movement. TSPAN31 is also associated with tumorigenesis and osteosarcoma. TSPAN31 Protein, Human (HEK293, Fc) is the recombinant human-derived TSPAN31 protein, expressed by HEK293 , with N-mFc labeled tag.

TSPAN31 regulates the proliferation, migration, and apoptosis of gastric cancer cells through co-expression with METTL1 and CCT2. As a prognostic factor and potential therapeutic target for gastric cancer, TSPAN31 plays a crucial role in the malignant potential of tumors through overexpression^[1].
TSPAN31 regulates cell survival and apoptosis signaling transduction^[2].

Human

HEK293

N-mFc

Q12999 (C94-K173)

6302  [NCBI]

Partial

CSCLAINRSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKHSDEALK

Approximately 43-55 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.