1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TSLP Protein, Human

TSLP Protein, Human is an epithelial cell-derived cytokine which plays key role in allergic inflammation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TSLP Protein, Human is an epithelial cell-derived cytokine which plays key role in allergic inflammation.

Background

Thymic stromal lymphopoietin (TSLP) is an epithelial cell derived cytokine expressed in skin, gut, lungs and thymus. TSLP signals via TSLPR, a heterodimer of the IL-7 receptor alpha chain (IL-7Rα) and the TSLP receptor chain (TSLPR). Thymic stromal lymphopoietin exerts profound influence on the polarization of dendritic cells (DCs) to drive T helper (Th) 2 cytokine production. It also directly promotes T cell proliferation in response to T cell receptor (TCR) activation, and Th2 cytokine production. Thymic stromal lymphopoietin also supports B cell expansion and differentiation. Thymic stromal lymphopoietin further amplifies Th2 cytokine production by mast cells and NKT cells[1]. Multiple innate immune cells express the TSLPR and respond to TSLP. For example, Thymic stromal lymphopoietin can enhance cytokine production from mast cells, NKT cells and eosinophils. In addition, Thymic stromal lymphopoietin has very recently been shown to induce eosinophil extracellular traps (EETs), extrusions of mitochondrial DNA toxic granule molecules released in response to infection[2].

Biological Activity

1.The ED50 is <0.3 ng/mL as measured by murine BaF3 pro-B cells, corresponding to a specific activity of >3.3 × 106 units/mg.
2.Immobilized Human TSLP at 10 μg/mL (100 μl/well) can bind Human TSLP R-Fc .The ED50 of Human TSLP R-Fc is <0.35 μg/mL.
3. Measured by its binding ability in a functional ELISA. Immobilized Human TSLP at 5 μg/mL (100μl/well) on the plate can bind Human TSLPR. The ED50 for this effect is 18.65 ng/mL.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q969D9-1 (Y29-Q159)

Gene ID
Molecular Construction
N-term
TSLP (Y29-Q159)
Accession # Q969D9-1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
rHuTSLP; TSLP
AA Sequence

YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Predicted Molecular Mass
15 kDa
Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, pH 7.4, 150 mM NaCl.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

TSLP Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TSLP Protein, Human
Cat. No.:
HY-P7057
Quantity:
MCE Japan Authorized Agent: