1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. TACI Protein
  6. TNFRSF13B Protein, Human

TNFRSF13B protein is a receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS and exhibits high-affinity binding to both ligands. Its activation stimulates B-cell and T-cell function and modulates humoral immunity through calcineurin-dependent NF-AT activation as well as NF-kappa-B and AP-1 activation. TNFRSF13B Protein, Human is the recombinant human-derived TNFRSF13B protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNFRSF13B protein is a receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS and exhibits high-affinity binding to both ligands. Its activation stimulates B-cell and T-cell function and modulates humoral immunity through calcineurin-dependent NF-AT activation as well as NF-kappa-B and AP-1 activation. TNFRSF13B Protein, Human is the recombinant human-derived TNFRSF13B protein, expressed by E. coli , with tag free.

Background

TNFRSF13B Protein serves as the receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS, demonstrating high-affinity binding to both ligands. Its activation results in calcineurin-dependent activation of NF-AT, along with the activation of NF-kappa-B and AP-1, thereby playing a crucial role in stimulating B- and T-cell function and regulating humoral immunity. Additionally, TNFRSF13B binds TRAF2, TRAF5, and TRAF6, suggesting its involvement in various signaling pathways. Notably, it interacts with the NH2-terminal domain of CAMLG using its C-terminus.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF13B at 2 μg/ml (100 μL/well) can bind biotinylated Human APRIL.The ED50 for this effect is 25.22 ng/mL.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O14836-1 (M1-V160)

Gene ID
Molecular Construction
N-term
TNFRSF13B (M1-V160)
Accession # O14836-1
C-term
Synonyms
CD 267; CD267; CD267 antigen; CVID; CVID2; FLJ39942; MGC133214; MGC39952; OTTHUMP00000065442; TNFRSF 13B; TNFRSF 14B; TNFRSF13B; TNFRSF13B protein; TNFRSF14B; TR13B_HUMAN; Transmembrane activator and CAML interactor; Tumor necrosis factor receptor 13B; Tumor necrosis factor receptor superfamily member 13B
AA Sequence

MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQV

Predicted Molecular Mass
18.0 kDa
Molecular Weight

Approximately 19.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

TNFRSF13B Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNFRSF13B Protein, Human
Cat. No.:
HY-P71911
Quantity:
MCE Japan Authorized Agent: