TMCO1 Protein, Human (Cell-Free, His)

TMCO1 Protein, Human (Cell-Free, His) is the recombinant human-derived TMCO1 protein, expressed by E. coli cell-free system, with N-10*His tag.

TMCO1 is an endoplasmic reticulum (ER) calcium-selective channel that prevents intracellular Ca2(+) stores from overfilling and maintains calcium homeostasis in the ER. In response to ER Ca2(+) overloading, TMCO1 assembles into a homotetramer, forming a functional calcium-selective channel that facilitates Ca2(+) release. It mediates ER Ca2(+) homeostasis in osteoblasts and plays a key role in bone formation via the CaMKII-HDAC4-RUNX2 signaling axis (by similarity). TMCO1 is a component of the multi-pass translocon (MPT) complex, which mediates the insertion of multi-pass membrane proteins into the lipid bilayer of membranes. The MPT complex takes over after the SEC61 complex: following membrane insertion of the first few transmembrane segments of proteins by the SEC61 complex, the MPT complex occludes the lateral gate of the SEC61 complex to promote insertion of subsequent transmembrane regions. Within the MPT complex, the GEL subcomplex may mediate the insertion of transmembrane regions into the membrane.

Human

E. coli Cell-free

N-10*His

Q9UM00 (M1-S188)

54499

Partial

STMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFTPLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.