1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. T Cell CD Proteins B Cell CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Pattern Recognition Receptors
  4. TLR4/CD284 TLR4/CD284 Toll-like Receptor
  5. TLR4/CD284
  6. TLR4 Protein, Human (sf9, His, Solution)

TLR4 is a transmembrane receptor that recognizes PAMPs and DAMPs and cooperates with LY96 for LPS detection. TLR4 activates MYD88-dependent and independent signaling pathways and participates in TIRAP, TRAF6 and CD14-mediated endocytosis. TLR4 Protein, Human (sf9, His, Solution) is the recombinant human-derived TLR4 protein, expressed by Sf9 insect cells, with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TLR4 is a transmembrane receptor that recognizes PAMPs and DAMPs and cooperates with LY96 for LPS detection. TLR4 activates MYD88-dependent and independent signaling pathways and participates in TIRAP, TRAF6 and CD14-mediated endocytosis. TLR4 Protein, Human (sf9, His, Solution) is the recombinant human-derived TLR4 protein, expressed by Sf9 insect cells, with C-His labeled tag.

Background

TLR4, a transmembrane receptor, operates as a pattern recognition receptor, detecting pathogen- and damage-associated molecular patterns (PAMPs and DAMPs) to initiate innate immune responses. At the plasma membrane, it collaborates with LY96 to recognize bacterial lipopolysaccharide (LPS), triggering an immune response. Moreover, TLR4 is involved in LPS-independent inflammatory responses induced by free fatty acids and Ni(2+). The receptor acts through signaling pathways involving MYD88, TIRAP, and TRAF6, leading to NF-kappa-B activation and cytokine secretion. Additionally, CD14-mediated TLR4 internalization via endocytosis initiates a MYD88-independent signaling pathway through the TICAM1-TBK1-IRF3 axis, resulting in type I interferon production. TLR4 activation also leads to the activation of the NLRP3 inflammasome and a positive feedback loop between autophagy and the NF-kappa-B signaling cascade. In complex with TLR6, TLR4 promotes inflammation in monocytes/macrophages, and ligand binding triggers internalization and an inflammatory response. TLR4's diverse interactions, including those with LY96, MYD88, TIRAP, TICAM2, NOX4, CNPY3, HSP90B1, CD36, WDFY1, SMPDL3B, CEACAM1, RFTN1, SCIMP, TRAF3IP3, and TREM1, further highlight its pivotal role in orchestrating immune responses and cellular signaling.

Biological Activity

Immobilized Recombinant Human TLR4 / CD284 Protein (His Tag) at 1 μg/mL (100 μl/well) on His Tag Antibody, Mouse MAb precoated (5 μg/mL, 100 μL/well) can bind Anti-TLR4 Antibody, the EC50 is 3.784-15 ng/mL.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

O00206-1 (E24-K631)

Gene ID

7099

Molecular Construction
N-term
TLR4 (E24-K631)
Accession # O00206-1
His
C-term
Protein Length

Partial

Synonyms
CD284; hToll; TLR-4; Toll like receptor 4 protein; TOLL
AA Sequence

ESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK

Predicted Molecular Mass
70.5 kDa
Molecular Weight

Approximately 68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Structure/Form
Monomer
Purity

Greater than 87% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, pH 6.0, 10% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

TLR4 Protein, Human (sf9, His, Solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TLR4 Protein, Human (sf9, His, Solution)
Cat. No.:
HY-P73586Y
Quantity:
MCE Japan Authorized Agent: