1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Tissue Inhibitor of Metalloproteinase (TIMPs)
  5. TIMP-2
  6. TIMP-2 Protein, Mouse (HEK293, His)

TIMP-2 is a tissue inhibitor of metalloproteinases that forms complexes with metalloproteinases, especially collagenases, effectively and irreversibly inactivating them by binding to their catalytic zinc cofactor.This interaction plays a crucial role in regulating the activity of metalloproteinases.TIMP-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TIMP-2 is a tissue inhibitor of metalloproteinases that forms complexes with metalloproteinases, especially collagenases, effectively and irreversibly inactivating them by binding to their catalytic zinc cofactor.This interaction plays a crucial role in regulating the activity of metalloproteinases.TIMP-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Tissue inhibitor of metalloproteinases-2 (TIMP-2) is a protein that forms complexes with metalloproteinases, including collagenases, leading to the irreversible inactivation of these enzymes by binding to their catalytic zinc cofactor. Notably, TIMP-2 exhibits a specific interaction with matrix metalloproteinase 2 (MMP2) through its C-terminal region. This interaction, particularly with the C-terminal PEX domain of MMP2, results in the inhibition of MMP2 activity. TIMP-2's ability to regulate metalloproteinases underscores its significance in controlling extracellular matrix remodeling, with implications for various physiological and pathological processes. (

Biological Activity

Measured by its ability to inhibit human MMP-2 cleavage of a fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2. The IC50 is 4.79 nM, as measured under the described conditions.

  • Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 this effect is 34.88 ng/mL, corresponding to a specific activity is 2.87×104 units/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P25785 (C27-P220)

Gene ID
Molecular Construction
N-term
TIMP-2 (C27-P220)
Accession # P25785
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
TIMP-2; CSC-21Ktissue inhibitor of metalloproteinase 2; metalloproteinase inhibitor 2; TIMP metalloproteinase inhibitor 2; Tissue inhibitor of metalloproteinase 2.
AA Sequence

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSITQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

TIMP-2 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIMP-2 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P71137
Quantity:
MCE Japan Authorized Agent: