1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Thymosin beta 4 Protein, Human

TMSB4X proteins play a critical role in cytoskeletal organization, influencing actin dynamics by binding and sequestering actin monomers. As a potent inhibitor of actin polymerization, it affects the cytoskeleton. Thymosin beta 4 Protein, Human is the recombinant human-derived Thymosin beta 4 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TMSB4X proteins play a critical role in cytoskeletal organization, influencing actin dynamics by binding and sequestering actin monomers. As a potent inhibitor of actin polymerization, it affects the cytoskeleton. Thymosin beta 4 Protein, Human is the recombinant human-derived Thymosin beta 4 protein, expressed by E. coli , with tag free.

Background

TMSB4X protein assumes a crucial role in cytoskeletal organization, as evidenced by its documented impact on actin dynamics. It functions by binding to and sequestering actin monomers (G actin), thereby acting as a potent inhibitor of actin polymerization. Beyond its influence on the cytoskeleton, TMSB4X emerges as a robust inhibitor of bone marrow-derived stem cell differentiation, exerting its effects by impeding the entry of hematopoietic pluripotent stem cells into the S-phase. These multifaceted functions underscore the significance of TMSB4X in orchestrating fundamental cellular processes, including cytoskeletal integrity and stem cell differentiation, highlighting its regulatory role in maintaining cellular homeostasis and orchestrating dynamic cellular responses.

Biological Activity

1.The biological activity determined by its ability to produce a protective effect against hydrogen peroxide in primary lung fibroblasts is in a concentration range of 0.5 - 10 μg/mL.
2.Measured in inhibiting cell proliferation assay using A549 cells. The ED50 for this effect is 1.824 μg/mL.

  • Measured in inhibiting cell proliferation assay using A549 cells. The ED50 for this effect is 1.824 μg/mL, corresponding to a specific activity is 5.482×102 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P62328 (S2-S44)

Gene ID
Molecular Construction
N-term
Tβ4 (S2-S44)
Accession # P62328
C-term
Protein Length

Full Length of Mature Protein

Synonyms
T beta-4; TMSB4X; TB4X; THYB4; TMSB4
AA Sequence

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Molecular Weight

Approximately 12 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg; determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Thymosin beta 4 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Thymosin beta 4 Protein, Human
Cat. No.:
HY-P72776
Quantity:
MCE Japan Authorized Agent: