1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. TGF-beta Superfamily Receptor Serine/Threonine Kinases Serine/Threonine Kinase Proteins
  4. TGF-beta Receptor TGF-β Receptor 1
  5. TGFBR1/ALK-5 Protein, Mouse (HEK293, Fc)

TGFBR1 is a transmembrane kinase that cooperates with TGFBR2 to form the TGF-β receptor complex.This complex is activated by cytokines and regulates a variety of processes, including cell cycle arrest, mesenchymal cell control, wound healing, and carcinogenesis.TGFBR1/ALK-5 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TGFBR1/ALK-5 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TGFBR1 is a transmembrane kinase that cooperates with TGFBR2 to form the TGF-β receptor complex.This complex is activated by cytokines and regulates a variety of processes, including cell cycle arrest, mesenchymal cell control, wound healing, and carcinogenesis.TGFBR1/ALK-5 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TGFBR1/ALK-5 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

TGFBR1, a transmembrane serine/threonine kinase, forms a complex with the TGF-beta type II serine/threonine kinase receptor, TGFBR2, constituting the specific receptor for TGF-beta cytokines, including TGFB1, TGFB2, and TGFB3. This receptor complex plays a crucial role in transducing signals from the cell surface to the cytoplasm, thereby regulating a diverse range of physiological and pathological processes. These include inducing cell cycle arrest in epithelial and hematopoietic cells, controlling mesenchymal cell proliferation and differentiation, influencing wound healing, extracellular matrix production, immunosuppression, and participating in carcinogenesis. The assembly of the receptor complex, consisting of two TGFBR1 and two TGFBR2 molecules symmetrically bound to the cytokine dimer, leads to the constitutive activation of TGFBR1 by the catalytically active TGFBR2. Activated TGFBR1 phosphorylates SMAD2, causing its dissociation from the receptor and subsequent interaction with SMAD4. The resulting SMAD2-SMAD4 complex translocates to the nucleus, where it modulates the transcription of TGF-beta-regulated genes, initiating the canonical SMAD-dependent TGF-beta signaling cascade. Additionally, TGFBR1 is involved in non-canonical, SMAD-independent TGF-beta signaling pathways. For instance, it induces TRAF6 autoubiquitination, leading to MAP3K7 ubiquitination and activation, triggering apoptosis. Moreover, TGFBR1 regulates epithelial to mesenchymal transition through a SMAD-independent signaling pathway involving PARD6A phosphorylation and activation.

Biological Activity

Measured  by its binding ability in a functional ELISA. When Recombinant Human TGF-beta  RII is immobilized at 1 μg/mL (100 μL/well), it binds Recombinant  Human TGF-beta RI in the presence of TGF-beta 1. The concentration of  rhTGF-beta RI that produces 50% of the optimal binding response is  approximately 0.835 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human TGF-beta  RII is immobilized at 1 μg/mL (100 μL/well), it binds Recombinant Human TGF-beta RI in the presence of TGF-beta 1. The concentration of rhTGF-beta RI that produces 50% of the optimal binding response is approximately 0.835 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q64729 (L30-E125)

Gene ID
Molecular Construction
N-term
TGFBR1 (L30-E125)
Accession # Q64729
hFc
C-term
Synonyms
TGF-beta receptor type-1; ALK-5; SKR4; TbetaR-I; AAT5
AA Sequence

LQCFCHLCTKDNFTCETDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGAVTTTYCCNQDHCNKIELPTTGPFSEKQSAGLGPVE

Molecular Weight

40-60 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TGFBR1/ALK-5 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P72454
Quantity:
MCE Japan Authorized Agent: