1. Recombinant Proteins
  2. Others
  3. SPARC Protein, Human (HEK293, His)

SPARC Protein, Human (HEK293, His)

Cat. No.: HY-P71094
COA Handling Instructions

SPARC proteins are essential for lipid transport and are involved in the production, transformation, and clearance of plasma lipoproteins. It interacts with different particles, shows a preference for HDL, and binds to cellular receptors such as LDLR and VLDLR to promote the uptake of APOE-containing lipoproteins. SPARC Protein, Human (HEK293, His) is the recombinant human-derived SPARC protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SPARC Protein, Human (HEK293, His) is 286 a.a., with molecular weight of ~38.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $50 In-stock
50 μg $110 In-stock
100 μg $175 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE SPARC Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SPARC proteins are essential for lipid transport and are involved in the production, transformation, and clearance of plasma lipoproteins. It interacts with different particles, shows a preference for HDL, and binds to cellular receptors such as LDLR and VLDLR to promote the uptake of APOE-containing lipoproteins. SPARC Protein, Human (HEK293, His) is the recombinant human-derived SPARC protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SPARC Protein, Human (HEK293, His) is 286 a.a., with molecular weight of ~38.0 kDa.

Background

APOE is a crucial protein involved in the transport of lipids between organs via plasma and interstitial fluids. It plays a vital role in the production, conversion, and clearance of plasma lipoproteins. APOE interacts with various lipoprotein particles, including chylomicrons, chylomicron remnants, VLDL, and IDL, with a particular preference for HDL. It also binds to numerous cellular receptors, such as LDLR and VLDLR, facilitating the uptake of APOE-containing lipoproteins by cells. Additionally, APOE possesses heparin-binding activity and binds to heparan-sulfate proteoglycans on cell surfaces, aiding in the capture and receptor-mediated uptake of APOE-containing lipoproteins. Furthermore, APOE forms a homotetramer and may interact with ABCA1 in HDL biogenesis. It can also interact with APP/A4 amyloid-beta peptide, MAPT, MAP2, secreted SORL1, and PMEL for various physiological processes.

Biological Activity

Measured by its ability to inhibit the cell growth of Mv-1-Lu mink lung epithelial cells. The ED50 for this effect is typically 2.503 μg/mL, corresponding to a specific activity is 400 U/mg.

  • Measured by its ability to inhibit the cell growth of Mv-1-Lu mink lung epithelial cells. The ED50 for this effect is typically 2.503 μg/mL, corresponding to a specific activity is 400 U/mg
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P09486 (A18-I303 )

Gene ID
Molecular Construction
N-term
SPARC (A18-I303 )
Accession # P09486
6*His
C-term
Synonyms
SPARC; Basement-Membrane Protein 40; BM-40; Osteonectin; ON; Secreted Protein Acidic and Rich in Cysteine; SPARC; ON
AA Sequence

APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

Molecular Weight

Approximately 38.0-46 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2 or PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SPARC Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SPARC Protein, Human (HEK293, His)
Cat. No.:
HY-P71094
Quantity:
MCE Japan Authorized Agent: