S100A1 Protein, Human (HEK293, hFc)

The S100A1 gene encodes a protein that regulates cellular processes, with potential roles in Ca2+ release, microtubule assembly, and protein phosphorylation. Decreased expression is linked to cardiomyopathies, highlighting its importance in heart-related conditions. It is abundantly expressed in the heart, salivary gland, and other tissues. S100A1 Protein, Human (HEK293, hFc) is the recombinant human-derived S100A1 protein, expressed by HEK293 , with N-hFc labeled tag.

The S100A1 gene encodes a protein that belongs to the S100 family, characterized by 2 EF-hand calcium-binding motifs. S100 proteins are distributed in the cytoplasm and/or nucleus of various cells, playing roles in the regulation of cellular processes like cell cycle progression and differentiation. With at least 13 members located in a cluster on chromosome 1q21, this protein may be involved in stimulating Ca2+-induced Ca2+ release, inhibiting microtubule assembly, and impeding protein kinase C-mediated phosphorylation. Notably, decreased expression of S100A1 has been associated with cardiomyopathies, emphasizing its potential significance in heart-related conditions. The gene exhibits biased expression, particularly abundant in the heart, salivary gland, and select other tissues.

Measured by its binding ability in a functional ELISA. When Recombinant Human S100A1 is immobilize at 1 μg/mL, 100 μL/well, it binds recombinant human HSP70/HSPA1A with the ED₅₀ value of 2.259 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human S100A1 is immobilize at 1 μg/mL, 100 μL/well, it binds recombinant human HSP70/HSPA1A with the ED₅₀ value of 2.259 μg/mL.

Human

HEK293

N-hFc

NP_006262.1 (G2-S94)

6271  [NCBI]

Full Length of Mature Protein

GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Approximately 40 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 10 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.