1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. QDPR Protein, Human (HEK293, His)

The QDPR protein plays a crucial role in cellular biopterin metabolism as it catalyzes the conversion of the quinone dihydrobiopterin into tetrahydrobiopterin. This enzymatic process is essential for the regeneration and recycling of tetrahydrobiopterin, a necessary cofactor for various enzymatic reactions, especially those involved in neurotransmitter synthesis and nitric oxide production Enzymatic reaction. QDPR Protein, Human (HEK293, His) is the recombinant human-derived QDPR protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The QDPR protein plays a crucial role in cellular biopterin metabolism as it catalyzes the conversion of the quinone dihydrobiopterin into tetrahydrobiopterin. This enzymatic process is essential for the regeneration and recycling of tetrahydrobiopterin, a necessary cofactor for various enzymatic reactions, especially those involved in neurotransmitter synthesis and nitric oxide production Enzymatic reaction. QDPR Protein, Human (HEK293, His) is the recombinant human-derived QDPR protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Quinoid dihydropteridine reductase (QDPR) is an enzyme that plays a critical role in the metabolism of biopterin compounds. Specifically, QDPR catalyzes the conversion of quinonoid dihydrobiopterin into tetrahydrobiopterin, a crucial cofactor in various biological processes. Tetrahydrobiopterin is involved in the synthesis of neurotransmitters, such as serotonin and dopamine, and serves as a cofactor for enzymes like phenylalanine hydroxylase, which is essential for amino acid metabolism. By facilitating the reduction of quinonoid dihydrobiopterin, QDPR contributes to the recycling and regeneration of tetrahydrobiopterin, ensuring its availability for various cellular processes. It has to highlight QDPR's specific catalytic function in the biopterin pathway, emphasizing its importance in maintaining the balance of biopterin cofactors critical for neurotransmitter synthesis and other essential biochemical reactions.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P09417 (A2-F244)

Gene ID
Molecular Construction
N-term
QDPR (A2-F244)
Accession # P09417
6*His
C-term
Synonyms
Dihydropteridine Reductase; HDHPR; Quinoid Dihydropteridine Reductase; QDPR; DHPR
AA Sequence

AAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF

Molecular Weight

Approximately 29.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

QDPR Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
QDPR Protein, Human (HEK293, His)
Cat. No.:
HY-P71092
Quantity:
MCE Japan Authorized Agent: