1. Recombinant Proteins
  2. Others
  3. PTS Protein, Human (His)

PTS proteins are critical in the biosynthesis of tetrahydrobiopterin, an important cofactor for aromatic amino acid hydroxylase. It catalyzes the conversion of 7,8-dihydroneopterin triphosphate to 6-pyruvoyltetrahydropterin, a key step in the biosynthetic pathway. PTS Protein, Human (His) is the recombinant human-derived PTS protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PTS proteins are critical in the biosynthesis of tetrahydrobiopterin, an important cofactor for aromatic amino acid hydroxylase. It catalyzes the conversion of 7,8-dihydroneopterin triphosphate to 6-pyruvoyltetrahydropterin, a key step in the biosynthetic pathway. PTS Protein, Human (His) is the recombinant human-derived PTS protein, expressed by E. coli , with N-His labeled tag.

Background

The PTS Protein plays a crucial role in the biosynthesis of tetrahydrobiopterin, a vital cofactor for aromatic amino acid hydroxylases. This enzyme is instrumental in catalyzing the transformation of 7,8-dihydroneopterin triphosphate into 6-pyruvoyl tetrahydropterin, a key step in the biosynthetic pathway. The catalytic activity of the PTS Protein underscores its significance in facilitating the conversion necessary for the production of tetrahydrobiopterin, essential for the proper functioning of aromatic amino acid hydroxylases.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q03393 (M1-E145)

Gene ID
Molecular Construction
N-term
His
PTS (M1-E145)
Accession # Q03393
C-term
Protein Length

Full Length

Synonyms
6-pyruvoyl tetrahydrobiopterin synthase; PTP synthase; PTPS; PTS
AA Sequence

MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE

Molecular Weight

Approximately 17 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 40% Glycerol, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PTS Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PTS Protein, Human (His)
Cat. No.:
HY-P73684
Quantity:
MCE Japan Authorized Agent: