1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. PPIC Protein, Human (Trx-His)

PPIC protein is a peptidyl-prolyl cis-trans isomerase (PPIase) that actively catalyzes the cis-trans isomerization of prolyl imide peptide bonds, which is a key step in protein folding. Its role in promoting conformational changes ensures correct folding and maturation of proteins, contributing to cellular proteostasis. PPIC Protein, Human (Trx-His) is the recombinant human-derived PPIC protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PPIC protein is a peptidyl-prolyl cis-trans isomerase (PPIase) that actively catalyzes the cis-trans isomerization of prolyl imide peptide bonds, which is a key step in protein folding. Its role in promoting conformational changes ensures correct folding and maturation of proteins, contributing to cellular proteostasis. PPIC Protein, Human (Trx-His) is the recombinant human-derived PPIC protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Background

PPIC Protein emerges as a peptidyl-prolyl cis-trans isomerase (PPIase), actively facilitating the cis-trans isomerization of proline imidic peptide bonds in oligopeptides, a crucial step in the intricate process of protein folding. By catalyzing these conformational changes, PPIC is anticipated to play a pivotal role in ensuring the correct folding and maturation of proteins, contributing to cellular protein homeostasis. The ability of PPIC to isomerize proline imidic peptide bonds underscores its significance in modulating the structural dynamics of polypeptides, ultimately influencing their functional integrity. This multifunctional enzymatic activity positions PPIC as a key player in cellular physiology, emphasizing the need for further exploration to uncover the specific molecular mechanisms and cellular pathways through which PPIC actively contributes to the intricate world of protein folding.

Biological Activity

Measured by its ability to convert the substrate, Suc-AAPF-pNA, from Cis to Trans formation. The specific activity is 776.34 pmol/min/μg.

Species

Human

Source

E. coli

Tag

N-Trx;N-6*His

Accession

P45877 (K31-D182)

Gene ID
Molecular Construction
N-term
Trx-6*His
PPIC (K31-D182)
Accession # P45877
C-term
Protein Length

Partial

Synonyms
Peptidyl-Prolyl Cis-Trans Isomerase C; PPIase C; Cyclophilin C; Rotamase C; PPIC; CYPC
AA Sequence

KRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATD

Molecular Weight

Approximately 34.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 10% glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PPIC Protein, Human (Trx-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PPIC Protein, Human (Trx-His)
Cat. No.:
HY-P71223
Quantity:
MCE Japan Authorized Agent: