1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGF & VEGFR
  4. VEGF
  5. PLGF
  6. PLGF Protein, Mouse (HEK293, His)

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor.PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis.PLGF Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

PLGF Protein, Mouse (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor.PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis.PLGF Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The PLGF Protein, a growth factor integral to angiogenesis and endothelial cell growth, exhibits stimulatory effects on both proliferation and migration of these cells. Functioning through its binding to the FLT1/VEGFR-1 receptor, PLGF plays a crucial role in orchestrating angiogenic processes. Additionally, it contributes to tumor growth, emphasizing its involvement in pathological angiogenesis. Structurally, PLGF exists as an antiparallel homodimer, connected by disulfide linkages. Furthermore, it can form heterodimers with VEGFA/VEGF, suggesting a dynamic role in the regulation of vascular growth and function. The multifaceted actions and structural arrangements of PLGF underscore its significance in modulating vascular processes and tumor development.

Biological Activity

Immobilized Mouse PLGF at 10μg/mL (100 μL/well) can Biotinylated Mouse VEGFR1 (HY-P73553). The ED50 for this effect is 0.2256 μg/mL.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P49764 (V19-P158)

Gene ID
Molecular Construction
N-term
PLGF (V19-P158)
Accession # P49764
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Placenta growth factor; PlGF; Plgf; D12S1900; PGFL; PLGF; PlGF-2; SHGC-10760
AA Sequence

VHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP

Predicted Molecular Mass
16.9 kDa
Molecular Weight

Approximately 27-30 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

PLGF Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PLGF Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70792
Quantity:
MCE Japan Authorized Agent: