1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGF & VEGFR
  4. VEGF
  5. PLGF
  6. PLGF-1 Protein, Human (N-His)

The PLGF-1 protein is a key growth factor for angiogenesis and endothelial cell growth, crucially stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. It coordinates the angiogenic process, regulates blood vessel growth, and exhibits additional binding capabilities to NRP1/neuropilin-1 and NRP2/neuropilin-2. PLGF-1 Protein, Human (N-His) is the recombinant human-derived PLGF-1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE PLGF-1 Protein, Human (N-His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PLGF-1 protein is a key growth factor for angiogenesis and endothelial cell growth, crucially stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. It coordinates the angiogenic process, regulates blood vessel growth, and exhibits additional binding capabilities to NRP1/neuropilin-1 and NRP2/neuropilin-2. PLGF-1 Protein, Human (N-His) is the recombinant human-derived PLGF-1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

PLGF-1 participates in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. PLGF-1 also binds to the receptor FLT1/VEGFR-1. PLGF-1 promotes cell tumor growth.

Biological Activity

Measured in a cell proliferation assay using HUVEC Human umbilical vein endothelial cells. The ED50 this effect is 20.22 ng/mL, corresponding to a specific activity is 4.95×104 units/mg.

  • Measured in a cell proliferation assay using HUVEC Human umbilical vein endothelial cells. The ED50 for this effect is 20.22 ng/mL, corresponding to a specific activity is 4.95×104 units/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P49763-2 (L19-R149)

Gene ID
Molecular Construction
N-term
6*His
PLGF-1 (L19-R149)
Accession # P49763-2
C-term
Protein Length

Partial

Synonyms
Placenta growth factor; PlGF; PGF; PGFL
AA Sequence

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR

Molecular Weight

Approximately 17 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PLGF-1 Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PLGF-1 Protein, Human (N-His)
Cat. No.:
HY-P74627A
Quantity:
MCE Japan Authorized Agent: