Pleiotrophin Protein, Human

Pleiotrophin is a secreted growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors to influence a variety of cellular processes. It binds to chondroitin sulfate (CS) groups, regulates proliferation, survival and differentiation, and inhibits long-term synaptic potentiation of neurons. Pleiotrophin Protein, Human is the recombinant human-derived Pleiotrophin protein, expressed by E. coli , with tag free. The total length of Pleiotrophin Protein, Human is 136 a.a., with molecular weight of ~15.3 kDa.

Pleiotrophin Protein is a secreted growth factor that transduces its signal through both cell-surface proteoglycan and non-proteoglycan receptors. It binds to the chondroitin sulfate (CS) groups of cell-surface proteoglycan receptors, regulating processes such as cell proliferation, survival, growth, differentiation, and migration in various tissues, including neurons and bone. Pleiotrophin also plays a crucial role in synaptic plasticity and learning-related behavior by inhibiting long-term synaptic potentiation. Through binding to PTPRZ1, Pleiotrophin neutralizes the negative charges of the CS chains, inducing PTPRZ1 clustering and inactivation of its phosphatase activity, leading to increased tyrosine phosphorylation of PTPRZ1 substrates, such as ALK, CTNNB1, or AFAP1L2, activating the PI3K-AKT pathway. It forms complexes with PTPRZ1 and integrin alpha-V/beta-3, stimulating endothelial cell migration. In the adult hippocampus, Pleiotrophin promotes dendritic arborization, spine development, and functional integration of newborn granule neurons through ALK by activating the AKT signaling pathway. Additionally, it interacts with GPC2, SDC3, and other receptors, mediating diverse functions related to bone formation, neural stem cell proliferation and differentiation, hematopoietic regeneration, and various physiological processes in the female reproductive system and auditory response. The intricate network of interactions underscores the multifaceted role of Pleiotrophin in cellular and tissue-level regulatory mechanisms.

Human

E. coli

Tag Free

P21246 (G33-D168)

5764  [NCBI]

GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

Approximately 18 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.