1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Pleiotrophin Protein, Human

Pleiotrophin is a secreted growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors to influence a variety of cellular processes. It binds to chondroitin sulfate (CS) groups, regulates proliferation, survival and differentiation, and inhibits long-term synaptic potentiation of neurons. Pleiotrophin Protein, Human is the recombinant human-derived Pleiotrophin protein, expressed by E. coli , with tag free. The total length of Pleiotrophin Protein, Human is 136 a.a., with molecular weight of ~15.3 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Pleiotrophin is a secreted growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors to influence a variety of cellular processes. It binds to chondroitin sulfate (CS) groups, regulates proliferation, survival and differentiation, and inhibits long-term synaptic potentiation of neurons. Pleiotrophin Protein, Human is the recombinant human-derived Pleiotrophin protein, expressed by E. coli , with tag free. The total length of Pleiotrophin Protein, Human is 136 a.a., with molecular weight of ~15.3 kDa.

Background

Pleiotrophin Protein is a secreted growth factor that transduces its signal through both cell-surface proteoglycan and non-proteoglycan receptors. It binds to the chondroitin sulfate (CS) groups of cell-surface proteoglycan receptors, regulating processes such as cell proliferation, survival, growth, differentiation, and migration in various tissues, including neurons and bone. Pleiotrophin also plays a crucial role in synaptic plasticity and learning-related behavior by inhibiting long-term synaptic potentiation. Through binding to PTPRZ1, Pleiotrophin neutralizes the negative charges of the CS chains, inducing PTPRZ1 clustering and inactivation of its phosphatase activity, leading to increased tyrosine phosphorylation of PTPRZ1 substrates, such as ALK, CTNNB1, or AFAP1L2, activating the PI3K-AKT pathway. It forms complexes with PTPRZ1 and integrin alpha-V/beta-3, stimulating endothelial cell migration. In the adult hippocampus, Pleiotrophin promotes dendritic arborization, spine development, and functional integration of newborn granule neurons through ALK by activating the AKT signaling pathway. Additionally, it interacts with GPC2, SDC3, and other receptors, mediating diverse functions related to bone formation, neural stem cell proliferation and differentiation, hematopoietic regeneration, and various physiological processes in the female reproductive system and auditory response. The intricate network of interactions underscores the multifaceted role of Pleiotrophin in cellular and tissue-level regulatory mechanisms.

Biological Activity

Measured by its ability to inhance proliferation of SH-SY5Y cells. The ED50 for this effect is 3.149 μg/mL, corresponding to a specific activity is 317.561 units/mg.

  • Measured by its ability to inhance proliferation of SH-SY5Y cells. The ED50 for this effect is 3.149 μg/mL, corresponding to a specific activity is 317.561 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P21246 (G33-D168)

Gene ID
Molecular Construction
N-term
Pleiotrophin (G33-D168)
Accession # P21246
C-term
Synonyms
HBBM; HBGF-8 ; HB-GAM; HBNF; OSF-1; Heparin-binding brain mitogen ; Heparin-binding neurite outgrowth-promoting factor ; Heparin-binding neurite outgrowth-promoting factor 1; Osteoblast-specific factor 1
AA Sequence

GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

Predicted Molecular Mass
15.3 kDa
Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE..
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Pleiotrophin Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Pleiotrophin Protein, Human
Cat. No.:
HY-P71907
Quantity:
MCE Japan Authorized Agent: