Plasminogen Protein, Human

Plasminogen protein is the key precursor of plasmin and plays a central role in a variety of physiological and pathological processes. Plasmin is derived from plasminogen and dissolves fibrin during blood coagulation, affecting embryonic development, tissue remodeling, tumor invasion and inflammation. Plasminogen Protein, Human is the recombinant human-derived Plasminogen protein, expressed by E. coli , with tag free.

Plasminogen Protein plays a crucial role in diverse physiological and pathological processes, functioning as the precursor to plasmin—a potent proteolytic factor with multifaceted activities. Plasmin's primary function involves the dissolution of fibrin in blood clots, contributing to processes such as embryonic development, tissue remodeling, tumor invasion, and inflammation. It weakens the walls of the Graafian follicle during ovulation and activates various enzymes, including urokinase-type plasminogen activator, collagenases, and complement zymogens such as C1 and C5. Plasmin's proteolytic action extends to cleaving fibronectin, laminin, fibrin, thrombospondin, and von Willebrand factor, resulting in cell detachment and apoptosis. Its involvement in tissue remodeling and tumor invasion may be modulated by CSPG4. Plasminogen also binds to cells, and the derived angiostatin serves as an angiogenesis inhibitor, blocking neovascularization and impeding the growth of experimental primary and metastatic tumors in vivo. The diverse roles of Plasminogen underscore its significance in orchestrating complex cellular and physiological processes.

Human

E. coli

Tag Free

P00747 (V98-P356)

5340  [NCBI]

Partial

VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSP

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.