1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGFs & PDGFRs
  4. PDGF
  5. PDGF-C
  6. PDGF-CC Protein, Human (HEK293, Fc)

PDGF-CC is a multifunctional growth factor that plays a crucial role in embryonic development, cellular processes, and tissue formation. It is essential for embryonic skeletal development, skin morphogenesis, and wound healing. PDGF-CC Protein, Human (HEK293, Fc) is the recombinant human-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDGF-CC is a multifunctional growth factor that plays a crucial role in embryonic development, cellular processes, and tissue formation. It is essential for embryonic skeletal development, skin morphogenesis, and wound healing. PDGF-CC Protein, Human (HEK293, Fc) is the recombinant human-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Background

PDGF-CC, a multifaceted growth factor, assumes a pivotal role in orchestrating diverse cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. As a potent mitogen and chemoattractant for mesenchymal cells, PDGF-CC is indispensable for the normal formation of the embryonic skeleton, particularly the craniofacial skeleton and palate. Its significance extends to skin morphogenesis during embryonic development and holds a critical position in wound healing, guiding the intricate stages of inflammation, proliferation, and remodeling. Moreover, PDGF-CC emerges as a key player in angiogenesis, blood vessel development, and fibrotic processes, where it contributes to the transformation of interstitial fibroblasts into myofibroblasts and collagen deposition. Beyond its role in maintaining PDGF domain latency, the CUB domain exhibits mitogenic activity in coronary artery smooth muscle cells. Intriguingly, within the nucleus, PDGF-CC appears to serve additional functions. Structurally, PDGF-CC forms homodimers linked by disulfide bonds and engages in interactions with PDGFRA homodimers, as well as heterodimers formed by PDGFRA and PDGFRB, highlighting its intricate involvement in a myriad of cellular activities. The CUB domain of PDGF-CC further interacts with PLAT, emphasizing its diverse and dynamic roles in cellular regulation.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q9NRA1-1 (V235-G345)

Gene ID
Molecular Construction
N-term
hFc
PDGF-CC (V235-G345)
Accession # Q9NRA1-1
C-term
Protein Length

Partial

Synonyms
PDGF-C; Platelet derived growth factor C; VEGF-E; SCDGF
AA Sequence

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Predicted Molecular Mass
39 kDa
Molecular Weight

Approximately 45 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PDGF-CC Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGF-CC Protein, Human (HEK293, Fc)
Cat. No.:
HY-P73353
Quantity:
MCE Japan Authorized Agent: