PD-1 Protein, Mouse (HEK293, His)

PD-1 Protein is an important immune regulatory molecule expressed on the surface of activated immune cells. By binding to its ligands (PD-L1/PD-L2), the PD-1 Protein exerts immunosuppressive effects. PD-1 Protein can be used in the research of tumors, autoimmune diseases, and other conditions. PD-1 Protein, Mouse (HEK293, His) is a recombinant PD-1 protein expressed by HEK293 cells and carries a C-6*His tag and glycosylation modification^[1][2].

PD-1, also known as CD279, is a 55 kDa transmembrane protein consisting of 288 amino acids, including a signal peptide, extracellular domain, transmembrane domain, and intracellular domain. As an immune checkpoint molecule, PD-1 is mainly expressed on the surface of activated immune cells such as T cells and B cells. Notably, PD-1 is highly expressed on tumor-specific T cells. PD-1 acts as an inhibitor of adaptive and innate immune responses. Under normal conditions, PD-1 maintains immune tolerance by binding to its ligands PD-L1/PD-L2 to avoid autoimmune damage. However, when PD-1 binds to PD-L1/PD-L2 on tumor cells, it leads to T cell functional exhaustion, inhibits cytokine secretion, and facilitates tumor immune escape. Currently, PD-1 serves as a core target for cancer immunotherapy, and its inhibitors can restore the tumor-killing ability of T cells by blocking this binding^[1][2].

1.Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625 ng/mL of bound hPD-L1. The ED₅₀ for this effect is <1 μg/mL.
2.Immobilized Recombinant Mouse PD-1 at 1 μg/ml (100 μl/well) can bind Recombinant Mouse PD-L1. The ED₅₀ for this effect is 0.5223 μg/mL.

• 
  Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625ng/mL of bound hPD-L1. The ED₅₀ for this effect is 0.986 μg/mL, corresponding to a specific activity is 1.01×10³ units/mg.

Mouse

HEK293

C-6*His

Q02242 (L25-Q167)

18566  [NCBI]

LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ

Approximately 25-43 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Han Y, et al. PD-1/PD-L1 pathway: current researches in cancer. Am J Cancer Res. 2020 Mar 1;10(3):727-742.  [Content Brief]

  [2]. Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18(12):e731-e741.  [Content Brief]