1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins
  4. PD-1
  5. PD-1 Protein, Mouse (HEK293, His)

PD-1 Protein is an important immune regulatory molecule expressed on the surface of activated immune cells. By binding to its ligands (PD-L1/PD-L2), the PD-1 Protein exerts immunosuppressive effects. PD-1 Protein can be used in the research of tumors, autoimmune diseases, and other conditions. PD-1 Protein, Mouse (HEK293, His) is a recombinant PD-1 protein expressed by HEK293 cells and carries a C-6*His tag and glycosylation modification.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

PD-1 Protein is an important immune regulatory molecule expressed on the surface of activated immune cells. By binding to its ligands (PD-L1/PD-L2), the PD-1 Protein exerts immunosuppressive effects. PD-1 Protein can be used in the research of tumors, autoimmune diseases, and other conditions. PD-1 Protein, Mouse (HEK293, His) is a recombinant PD-1 protein expressed by HEK293 cells and carries a C-6*His tag and glycosylation modification[1][2].

Background

PD-1, also known as CD279, is a 55 kDa transmembrane protein consisting of 288 amino acids, including a signal peptide, extracellular domain, transmembrane domain, and intracellular domain. As an immune checkpoint molecule, PD-1 is mainly expressed on the surface of activated immune cells such as T cells and B cells. Notably, PD-1 is highly expressed on tumor-specific T cells. PD-1 acts as an inhibitor of adaptive and innate immune responses. Under normal conditions, PD-1 maintains immune tolerance by binding to its ligands PD-L1/PD-L2 to avoid autoimmune damage. However, when PD-1 binds to PD-L1/PD-L2 on tumor cells, it leads to T cell functional exhaustion, inhibits cytokine secretion, and facilitates tumor immune escape. Currently, PD-1 serves as a core target for cancer immunotherapy, and its inhibitors can restore the tumor-killing ability of T cells by blocking this binding[1][2].

Biological Activity

1.Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625 ng/mL of bound hPD-L1. The ED50 for this effect is <1 μg/mL.
2.Immobilized Mouse PD-1 at 1 μg/ml (100 μl/well) can bind Biotinylated Mouse PD-L1, Fc (HY-P70633). The ED50 for this effect is <1 μg/mL.
3.Immobilized Mouse PD-1 at 1 μg/mL (100 μL/well) can bind Biotinylated Mouse PD-L1, His (HY-P70632). The ED50 for this effect is <1 μg/mL.

  • Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625ng/mL of bound hPD-L1. The ED50 for this effect is 0.986 μg/mL, corresponding to a specific activity is 1.01×103 units/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q02242 (L25-Q167)

Gene ID
Molecular Construction
N-term
PD-1 (L25-Q167)
Accession # Q02242
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
Programmed cell death protein 1; PD-1; CD279; Pdcd1; mPD-1
AA Sequence

LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ

Molecular Weight

Approximately 25-43 kDa due to the glycosylation.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PD-1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70640
Quantity:
MCE Japan Authorized Agent: