1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins
  4. PD-1
  5. PD-1 Protein, Human (C93S, HEK293, His)

PD-1 protein is an inhibitory receptor on T cells that maintains immune tolerance by binding to CD274/PDCD1L1 and CD273/PDCD1LG2. It blocks T cell activation by binding to CD3-TCR and recruiting PTPN11/SHP-2 to dephosphorylate key signaling molecules. PD-1 Protein, Human (C93S, HEK293, His) is the recombinant human-derived PD-1 protein, expressed by HEK293 , with C-6*His labeled tag and C93S mutation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PD-1 protein is an inhibitory receptor on T cells that maintains immune tolerance by binding to CD274/PDCD1L1 and CD273/PDCD1LG2. It blocks T cell activation by binding to CD3-TCR and recruiting PTPN11/SHP-2 to dephosphorylate key signaling molecules. PD-1 Protein, Human (C93S, HEK293, His) is the recombinant human-derived PD-1 protein, expressed by HEK293 , with C-6*His labeled tag and C93S mutation.

Background

PD-1 protein functions as an inhibitory receptor on antigen-activated T-cells, playing a crucial role in the induction and maintenance of immune tolerance to self. Upon binding to its ligands CD274/PDCD1L1 and CD273/PDCD1LG2, PD-1 delivers inhibitory signals and associates with CD3-TCR in the immunological synapse, directly impeding T-cell activation. This inhibitory action is further executed through the recruitment of PTPN11/SHP-2, leading to the dephosphorylation of key TCR proximal signaling molecules. Exploited by tumors to attenuate anti-tumor immunity, PD-1's interaction with CD274/PDCD1L1 inhibits cytotoxic T lymphocytes (CTLs) effector function. Blockage of the PD-1-mediated pathway has shown promise in reversing the exhausted T-cell phenotype and normalizing the anti-tumor response, providing a rationale for cancer immunotherapy.

Biological Activity

2 μg/mL (100 μL/well) of immobilized Human PD-1-His can bind Anti-Human PD-1 with an ED50 value of 11.55 ng/mL, corresponding to an affinity constant of 4.97 nM.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q15116 (L25-Q167,C93S)

Gene ID
Molecular Construction
N-term
PD-1 (L25-Q167,C93S)
Accession # Q15116
6*His
C-term
Synonyms
Programmed cell death protein 1; PDCD1; PD-1; hPD-1; CD279
AA Sequence

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDSRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQ

Molecular Weight

23-38 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PD-1 Protein, Human (C93S, HEK293, His)
Cat. No.:
HY-P70799
Quantity:
MCE Japan Authorized Agent: