1. Recombinant Proteins
  2. Enzymes & Regulators
  3. NAD-ME Protein, Human (N-His)

NAD-ME, a mitochondrial malic enzyme, relies on NAD and catalyzes the oxidative decarboxylation of malate to pyruvate within the mitochondria. Essential for cellular energy metabolism and the tricarboxylic acid (TCA) cycle, NAD-ME links metabolic pathways, influencing energy production and precursor molecule generation. Its enzymatic role is pivotal for balancing cellular redox reactions and meeting the cell's metabolic demands. NAD-ME Protein, Human (N-His) is the recombinant human-derived NAD-ME protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NAD-ME, a mitochondrial malic enzyme, relies on NAD and catalyzes the oxidative decarboxylation of malate to pyruvate within the mitochondria. Essential for cellular energy metabolism and the tricarboxylic acid (TCA) cycle, NAD-ME links metabolic pathways, influencing energy production and precursor molecule generation. Its enzymatic role is pivotal for balancing cellular redox reactions and meeting the cell's metabolic demands. NAD-ME Protein, Human (N-His) is the recombinant human-derived NAD-ME protein, expressed by E. coli , with C-6*His labeled tag.

Background

NAD-ME is a mitochondrial malic enzyme characterized by its dependence on NAD and its role in catalyzing the oxidative decarboxylation of malate to pyruvate. This enzymatic activity takes place within the mitochondria, contributing to cellular energy metabolism and the tricarboxylic acid (TCA) cycle. By facilitating the conversion of malate to pyruvate, NAD-ME plays a crucial role in linking various metabolic pathways, impacting both energy production and the generation of precursor molecules. This enzymatic function is integral to maintaining the balance of cellular redox reactions and supporting the metabolic demands of the cell.

Biological Activity

Measured by its ability to catalyzed the reduction of NAD+ to NADH, and the rate of NADH increase was measured at 340 nm. The enzyme activity is 5.54×103 U/mg prot.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P23368-1 (L19-E584)

Gene ID
Molecular Construction
N-term
NAD-ME (L19-E584)
Accession # P23368-1
6*His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Malate dehydrogenase; Malic enzyme 2; Malic enzyme 2 mitochondrial; Malic enzyme 2 NAD+; dependent mitochondrial; Malic enzyme mitochondrial; Malic enzyme NAD+; dependent mitochondrial; MAOM_HUMAN; ME 2; ME2; mitochondrial; NAD dependent malic enzyme mitochondrial; NAD ME; NAD-dependent malic enzyme; NAD-ME; ODS1; Pyruvic malic carboxylase
AA Sequence

LHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE

Molecular Weight

approximately 65 kD

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NAD-ME Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NAD-ME Protein, Human (N-His)
Cat. No.:
HY-P71918A
Quantity:
MCE Japan Authorized Agent: