1. Recombinant Proteins
  2. Others
  3. LOX Protein, Human (C-His)

LOX proteins play a critical role in the post-translational oxidative deamination of peptidyl lysine residues in collagen and elastin precursors, thereby shaping extracellular matrix dynamics. It regulates Ras expression, suggesting potential tumor suppressive effects, affecting cellular homeostasis and cancer-related processes. LOX Protein, Human (C-His) is the recombinant human-derived LOX protein, expressed by E. coli, with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LOX proteins play a critical role in the post-translational oxidative deamination of peptidyl lysine residues in collagen and elastin precursors, thereby shaping extracellular matrix dynamics. It regulates Ras expression, suggesting potential tumor suppressive effects, affecting cellular homeostasis and cancer-related processes. LOX Protein, Human (C-His) is the recombinant human-derived LOX protein, expressed by E. coli, with C-6*His labeled tag.

Background

The LOX protein assumes a pivotal role in the post-translational oxidative deamination of peptidyl lysine residues within precursors to fibrous collagen and elastin, as highlighted by its involvement in the modification of these structural proteins. Acting as a regulator of Ras expression, LOX also exhibits potential implications in tumor suppression, suggesting a multifaceted role in cellular homeostasis and cancer-related processes. Additionally, the protein is implicated in shaping the architecture of the aortic wall, contributing to the structural integrity and function of this crucial vascular component. The diverse functions of LOX underscore its significance in extracellular matrix dynamics, Ras regulation, and potential tumor suppressive mechanisms, making it a key player in cellular and tissue homeostasis.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P28300 (P174-Y417)

Gene ID

4015

Molecular Construction
N-term
LOX (P174-Y417)
Accession # P28300
6*His
C-term
Protein Length

Partial

Synonyms
LOX; Protein-lysine 6-oxidase; Lysyl oxidase
AA Sequence

PYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Predicted Molecular Mass
35.3 kDa
Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

Structure/Form
Monomer
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

Lyophilized powder.

Documentation

LOX Protein, Human (C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LOX Protein, Human (C-His)
Cat. No.:
HY-P704257
Quantity:
MCE Japan Authorized Agent: