LOX Protein, Human (C-His)

LOX proteins play a critical role in the post-translational oxidative deamination of peptidyl lysine residues in collagen and elastin precursors, thereby shaping extracellular matrix dynamics. It regulates Ras expression, suggesting potential tumor suppressive effects, affecting cellular homeostasis and cancer-related processes. LOX Protein, Human (C-His) is the recombinant human-derived LOX protein, expressed by E. coli, with C-6*His labeled tag.

The LOX protein assumes a pivotal role in the post-translational oxidative deamination of peptidyl lysine residues within precursors to fibrous collagen and elastin, as highlighted by its involvement in the modification of these structural proteins. Acting as a regulator of Ras expression, LOX also exhibits potential implications in tumor suppression, suggesting a multifaceted role in cellular homeostasis and cancer-related processes. Additionally, the protein is implicated in shaping the architecture of the aortic wall, contributing to the structural integrity and function of this crucial vascular component. The diverse functions of LOX underscore its significance in extracellular matrix dynamics, Ras regulation, and potential tumor suppressive mechanisms, making it a key player in cellular and tissue homeostasis.

Human

E. coli

C-6*His

P28300 (P174-Y417)

4015

Partial

PYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Approximately 35 kDa,based on SDS-PAGE under reducing conditions.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.