1. Recombinant Proteins
  2. Others
  3. LGALSL Protein, Human (His)

The LGALSL protein was identified as a member of the galectin family, exhibits no affinity for lactose, and may not be involved in carbohydrate binding. This unique feature distinguishes LGALSL from typical galectins, which are known for their carbohydrate recognition domain and interaction with specific sugar moieties. LGALSL Protein, Human (His) is the recombinant human-derived LGALSL protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LGALSL protein was identified as a member of the galectin family, exhibits no affinity for lactose, and may not be involved in carbohydrate binding. This unique feature distinguishes LGALSL from typical galectins, which are known for their carbohydrate recognition domain and interaction with specific sugar moieties. LGALSL Protein, Human (His) is the recombinant human-derived LGALSL protein, expressed by E. coli , with C-6*His labeled tag.

Background

LGALSL protein, based on available information, does not exhibit lactose-binding activity and may not bind carbohydrates. Lactose is a disaccharide sugar found in milk, and the lack of binding to lactose suggests a distinct functional role for LGALSL. Furthermore, LGALSL is described as a monomeric protein, indicating that it exists as a single, independent unit without forming complexes with other molecules. The absence of lactose binding and a potential lack of carbohydrate binding highlight the specificity and uniqueness of LGALSL's molecular interactions. Further investigations are warranted to elucidate the precise functions and biological significance associated with LGALSL, shedding light on its role within cellular processes and potential implications in various physiological contexts. (

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q3ZCW2 (A2-G172)

Gene ID
Molecular Construction
N-term
LGALSL (A2-G172)
Accession # Q3ZCW2
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Galectin-Related Protein; Lectin Galactoside-Binding-Like Protein; LGALSL; GRP; HSPC159
AA Sequence

AGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG

Molecular Weight

Approximately 18.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

LGALSL Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LGALSL Protein, Human (His)
Cat. No.:
HY-P70851
Quantity:
MCE Japan Authorized Agent: