1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. KYNU/Kynureninase Protein, Human (sf9, His)

KYNU, a multifaceted enzyme, plays a pivotal role in the catabolism of tryptophan by catalyzing the cleavage of L-kynurenine (L-Kyn) and L-3-hydroxykynurenine (L-3OHKyn) into anthranilic acid (AA) and 3-hydroxyanthranilic acid (3-OHAA), respectively. Demonstrating a preference for the L-3-hydroxy form, KYNU exhibits cysteine-conjugate-beta-lyase activity, showcasing its versatility in various metabolic pathways. KYNU/Kynureninase Protein, Human (sf9, His) is the recombinant human-derived KYNU/Kynureninase protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KYNU, a multifaceted enzyme, plays a pivotal role in the catabolism of tryptophan by catalyzing the cleavage of L-kynurenine (L-Kyn) and L-3-hydroxykynurenine (L-3OHKyn) into anthranilic acid (AA) and 3-hydroxyanthranilic acid (3-OHAA), respectively. Demonstrating a preference for the L-3-hydroxy form, KYNU exhibits cysteine-conjugate-beta-lyase activity, showcasing its versatility in various metabolic pathways. KYNU/Kynureninase Protein, Human (sf9, His) is the recombinant human-derived KYNU/Kynureninase protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

Kynureninase (KYNU) is a pivotal enzyme that catalyzes the cleavage of L-kynurenine (L-Kyn) and L-3-hydroxykynurenine (L-3OHKyn) into anthranilic acid (AA) and 3-hydroxyanthranilic acid (3-OHAA), respectively. Notably, KYNU exhibits a preference for the L-3-hydroxy form in its enzymatic activity. In addition to its role in the kynurenine pathway, KYNU displays cysteine-conjugate-beta-lyase activity, adding another layer to its functional versatility. This enzymatic versatility positions KYNU as a key player in the metabolism of tryptophan-derived compounds, highlighting its significance in regulating the levels of bioactive molecules such as anthranilic acid and 3-hydroxyanthranilic acid, and emphasizing its broader involvement in cellular processes.

Biological Activity

Measured by its ability to oxidize 3-hydroxykynurenine.The specific activity is > 200 pmoles/min/μg.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

Q16719 (M1-N465)

Gene ID
Molecular Construction
N-term
KYNU (M1-N465)
Accession # Q16719
His
C-term
Protein Length

Full Length

Synonyms
Kynureninase; L-kynurenine hydrolase; KYNU; EC:3.7.1.3
AA Sequence

MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECF

Molecular Weight

Approximately 47 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.0, 25% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

KYNU/Kynureninase Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KYNU/Kynureninase Protein, Human (sf9, His)
Cat. No.:
HY-P75903
Quantity:
MCE Japan Authorized Agent: