1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Kallikrein-7 Protein, Human (HEK293, His)

Kallikrein-7 is a serine protease with chymotrypsin-like activity that plays a role in intercellular proteolysis, leading to epidermal exfoliation. It is involved in cancer invasion and metastasis, and elevated expression is associated with poor prognosis and cancer progression. Kallikrein-7 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-7 protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Kallikrein-7 is a serine protease with chymotrypsin-like activity that plays a role in intercellular proteolysis, leading to epidermal exfoliation. It is involved in cancer invasion and metastasis, and elevated expression is associated with poor prognosis and cancer progression. Kallikrein-7 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-7 protein, expressed by HEK293 , with C-10*His labeled tag.

Background

Kallikrein-7, a member of the kallikrein subfamily of serine proteases, exhibits chymotrypsin-like activity and participates in the proteolysis of intercellular cohesive structures preceding desquamation, the shedding of the outermost epidermal layer. This enzyme's diverse physiological functions extend to its involvement in cancer-related processes, including invasion and metastasis. Elevated expression of the Kallikrein-7 gene is associated with an unfavorable prognosis and the progression of various cancer types. Polymorphisms in this gene may contribute to the development of atopic dermatitis. Situated within a gene cluster on chromosome 19, this gene has multiple alternatively spliced transcript variants, reflecting its complexity and involvement in various cellular processes. With biased expression observed in skin (RPKM 68.1) and esophagus (RPKM 25.3), Kallikrein-7 emerges as a multifaceted protease with implications in both normal physiology and disease states.

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate Mca-RPKPVE-Nval-WRK (Dnp) NH2 and the specific activity is >150 pmoles/min/μg. (Activation description: The proenzyme needs to be activated by Thermolysin for an activated form.)

Species

Human

Source

HEK293

Tag

C-10*His

Accession

NP_005037.1 (E23-R253)

Gene ID
Molecular Construction
N-term
Kallikrein-7 (E23-R253)
Accession # NP_005037.1
10*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Kallikrein-7; Serine protease 6; hSCCE; KLK7; PRSS6; SCCE
AA Sequence

EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR

Molecular Weight

30-33 kDa.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Kallikrein-7 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Kallikrein-7 Protein, Human (HEK293, His)
Cat. No.:
HY-P76466
Quantity:
MCE Japan Authorized Agent: