1. Recombinant Proteins
  2. Receptor Proteins
  3. Killer-Cell Immunoglobulin-like Receptors
  4. KIR2DS3
  5. KIR2DS3 Protein, Human (P.pastoris, His)

KIR2DS3, present on NK cells, selectively recognizes HLA-C alleles. In contrast to inhibitory KIRs, KIR2DS3 lacks inhibitory effects on NK cell activity. Its role is likely in activating or modulating NK cell functions, contributing to the nuanced balance of signals regulating the immune response. KIR2DS3 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS3 protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KIR2DS3, present on NK cells, selectively recognizes HLA-C alleles. In contrast to inhibitory KIRs, KIR2DS3 lacks inhibitory effects on NK cell activity. Its role is likely in activating or modulating NK cell functions, contributing to the nuanced balance of signals regulating the immune response. KIR2DS3 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS3 protein, expressed by P. pastoris , with N-His labeled tag.

Background

KIR2DS3, expressed on natural killer (NK) cells, serves as a receptor specifically recognizing HLA-C alleles. In contrast to inhibitory KIRs, KIR2DS3 does not exert inhibitory effects on NK cell activity. Instead, it likely plays a role in activating or modulating NK cell functions, contributing to the intricate balance of signals that regulate the immune response.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

Q14952 (H22-H245)

Gene ID

3808  [NCBI]

Molecular Construction
N-term
His
KIR2DS3 (H22-H245)
Accession # Q14952
C-term
Protein Length

Extracellular Domain

Synonyms
KIR2DS3; NKAT7Killer cell immunoglobulin-like receptor 2DS3; MHC class I NK cell receptor; Natural killer-associated transcript 7; NKAT-7
AA Sequence

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Molecular Weight

Approximately 70 kDa

Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

KIR2DS3 Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KIR2DS3 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P71815
Quantity:
MCE Japan Authorized Agent: