1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-4
  5. IL-4 Protein, Rhesus macaque

IL-4 protein actively engages in B-cell activation, serving as a costimulator for DNA synthesis, inducing class II MHC molecule expression, and enhancing IgE and IgG1 secretion. It regulates CD23 expression on lymphocytes and monocytes, positively influences IL31RA expression in macrophages, and induces autophagy in dendritic cells through mTORC1 signaling interference and RUFY4 induction. IL-4 Protein, Rhesus macaque is the recombinant Rhesus Macaque-derived IL-4 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-4 protein actively engages in B-cell activation, serving as a costimulator for DNA synthesis, inducing class II MHC molecule expression, and enhancing IgE and IgG1 secretion. It regulates CD23 expression on lymphocytes and monocytes, positively influences IL31RA expression in macrophages, and induces autophagy in dendritic cells through mTORC1 signaling interference and RUFY4 induction. IL-4 Protein, Rhesus macaque is the recombinant Rhesus Macaque-derived IL-4 protein, expressed by E. coli , with tag free.

Background

IL-4 protein actively participates in various B-cell activation processes and other cell types, acting as a costimulator of DNA synthesis. Moreover, it induces the expression of class II MHC molecules on resting B-cells and enhances the secretion and cell surface expression of IgE and IgG1. IL-4 also plays a regulatory role in the expression of the low affinity Fc receptor for IgE (CD23) on lymphocytes and monocytes. Additionally, it positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4.

Biological Activity

The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 1.0 ng/mL, corresponding to a specific activity of >1.0x106 IU/mg.

  • Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.2042 ng/mL, corresponding to a specific activity is 4.897×106 U/mg
Species

Rhesus Macaque

Source

E. coli

Tag

Tag Free

Accession

P51492 (H25-S153)

Gene ID
Molecular Construction
N-term
IL-4 (H25-S153)
Accession # P51492
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IL4Interleukin-4; IL-4; B-cell stimulatory factor 1; BSF-1; Lymphocyte stimulatory factor 1
AA Sequence

HNCHIALREIIETLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLEDFLERLKTIMREKYSKCSS

Molecular Weight

Approximately 14.9 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of 2 xPBS, 5 % Trehalose, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-4 Protein, Rhesus macaque Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-4 Protein, Rhesus macaque
Cat. No.:
HY-P71859
Quantity:
MCE Japan Authorized Agent: