1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-4
  5. IL-4 Protein, Canine

The IL-4 protein actively participates in the B cell activation process, acting as a costimulator for DNA synthesis. It induces the expression of class II MHC molecules on resting B cells, enhances IgE and IgG1 secretion and cell surface expression, and modulates CD23 expression on lymphocytes and monocytes. IL-4 Protein, Canine is the recombinant canine-derived IL-4 protein, expressed by E. coli , with N-Met labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IL-4 protein actively participates in the B cell activation process, acting as a costimulator for DNA synthesis. It induces the expression of class II MHC molecules on resting B cells, enhances IgE and IgG1 secretion and cell surface expression, and modulates CD23 expression on lymphocytes and monocytes. IL-4 Protein, Canine is the recombinant canine-derived IL-4 protein, expressed by E. coli , with N-Met labeled tag.

Background

IL-4 protein actively participates in multiple B-cell activation processes and various cell types, serving as a costimulator of DNA synthesis. It induces the expression of class II MHC molecules on resting B-cells, enhances the secretion and cell surface expression of IgE and IgG1, and regulates the expression of the low affinity Fc receptor for IgE (CD23) on lymphocytes and monocytes. Furthermore, IL-4 positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4.

Biological Activity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells and the ED50 is typically 5-30 ng/mL.

Species

Canine

Source

E. coli

Tag

Tag Free

Accession

O77762 (H25-H132)

Gene ID
Molecular Construction
N-term
Met
IL-4 (H25-H132)
Accession # O77762
C-term
Synonyms
Interleukin-4; IL-4; B-cell stimulatory factor 1; BSF-1
AA Sequence

HNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKYYRH

Molecular Weight

12-14 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-4 Protein, Canine Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-4 Protein, Canine
Cat. No.:
HY-P73214
Quantity:
MCE Japan Authorized Agent: