1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-4
  5. IL-4 Protein, Mouse

IL-4 Protein is a pleiotropic cytokine secreted by immune cells such as Th2. IL-4 Protein is involved in various processes, including humoral immunity, Th cell differentiation, allergic reactions, and inflammatory responses. IL-4 Protein plays a key role in immune responses and inflammatory reactions. IL-4 Protein, Mouse is a recombinant IL-4 protein expressed by E. coli without a tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-4 Protein is a pleiotropic cytokine secreted by immune cells such as Th2. IL-4 Protein is involved in various processes, including humoral immunity, Th cell differentiation, allergic reactions, and inflammatory responses. IL-4 Protein plays a key role in immune responses and inflammatory reactions. IL-4 Protein, Mouse is a recombinant IL-4 protein expressed by E. coli without a tag[1][2][3].

Background

IL-4 is a core cytokine of the Th2-type immune response. As a pleiotropic cytokine, IL-4 is secreted by various cells such as Th2 cells, NKT cells, and mast cells. By binding to type I and type II receptors, IL-4 activates signaling pathways including JAK-STAT6, playing a central role in Th2 cell differentiation, B-cell immunoglobulin class switching (such as the production of IgE and IgG1), and M2 macrophage polarization. Aberrant expression of IL-4 is closely associated with allergic diseases like asthma and atopic dermatitis, as well as immune responses to parasitic infections[1][2][3].

In Vitro

IL-4 Protein (Mouse; 0-10 ng/mL; 0-10 days) can prolong the survival time of mouse peritoneal exudate macrophages (PEM) in vitro. When used in combination with M-CSF (HY-P7050), it promotes cell proliferation, while when used in combination with GM-CSF (HY-P7361), it inhibits cell proliferation[4].
IL-4 Protein (Mouse; 0-50 ng/mL; 48-120 h) can induce the proliferation of lymph node cells in BALB/c mice and induce Th2 differentiation and IL-4 production in CD4+ T cells of BALB/c mice[5].

In Vivo

IL-4 protein (Mouse; 0.5-5 μg/kg; subcutaneous injection; 30 days) can improve psoriatic-like phenotypes, reduce inflammatory cell infiltration, decrease the expression of adhesion molecules, and exhibit activities in improving angiogenesis and inflammation in K14-VEGF transgenic mice[6].

Biological Activity

1. Measured in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells. The ED50 for this effect is ≤10 pg/mL.
2. Measured in a cell proliferation assay using HT-2 cells. The ED50 for this effect is ≤1.437 ng/mL, corresponding to a specific activity is ≥6.96×105 units/mg.

  • Measured in a cell proliferation assay using HT-2 cells. The ED50 for this effect is 1.437 ng/mL, corresponding to a specific activity is 6.96×105 units/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P07750 (H23-S140)

Gene ID
Molecular Construction
N-term
IL-4 (H23-S140)
Accession # P07750
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-4; B-cell IgG differentiation factor; B-cell growth factor 1; B-cell stimulatory factor 1; IGG1 induction factor; Lymphocyte stimulatory factor 1; IL-4; BSF-1
AA Sequence

HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Molecular Weight

Approximately 12-15 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 300 mM NaCl, 5% Trehalose, pH 6.5 or PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-4 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-4 Protein, Mouse
Cat. No.:
HY-P70644
Quantity:
MCE Japan Authorized Agent: