IL-36 alpha/IL-1F6 Protein, Human (158a.a)

IL-36 α/IL-1F6 protein binds to IL1RL2/IL-36R receptor, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses. IL-36 α/IL-1F6 also upregulates CD83, CD86, and HLA-DR in dendritic cells, promotes dendritic cell maturation, and drives T cell proliferation. IL-36 alpha/IL-1F6 Protein, Human (158a.a) is the recombinant human-derived IL-36 alpha/IL-1F6 protein, expressed by E. coli , with tag free.

IL-36 alpha/IL-1F6 protein, a cytokine, binds to and signals through the IL1RL2/IL-36R receptor, activating the NF-kappa-B and MAPK signaling pathways in target cells, thereby contributing to a pro-inflammatory response. As part of the IL-36 signaling system, it is believed to be present in epithelial barriers and involved in local inflammatory responses, sharing similarities with the IL-1 system through the coreceptor IL1RAP. IL-36 alpha/IL-1F6 appears to play a crucial role in skin inflammatory responses by influencing keratinocytes, dendritic cells, and indirectly impacting T-cells, promoting tissue infiltration, cell maturation, and cell proliferation. In cultured keratinocytes, it induces the expression of various chemokines and pro-inflammatory cytokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20, CXCL1, TNF-alpha, IL-8, and IL-6. Additionally, IL-36 alpha/IL-1F6 up-regulates the expression of IL-1A, IL-1B, and IL-6 in cultured monocytes, promotes cell maturation in myeloid dendritic cells, and facilitates dendritic cell maturation while driving T-cell proliferation in monocyte-derived dendritic cells. Its interaction with TMED10 mediates translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion. Furthermore, IL-36 alpha/IL-1F6 may contribute to pro-inflammatory effects in the lung.

Human

E. coli

Tag Free

Q9UHA7 (M1-F158)

27179  [NCBI]

Full Length

MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.