1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-36
  5. IL-36 alpha
  6. IL-36 alpha/IL-1F6 Protein, Human

IL-36 alpha (IL-1F6), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 alpha mediates inflammatory response. IL-36 alpha binds to IL-36R and activates NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases. IL-36 alpha also binds to IL-1Rrp2 and recruit IL-1RAcP. IL-36 alpha activats the MAPK, Erk1/2 and JNK through IL-36R/IL-1RAcP. IL-36 alpha/IL-1F6 Protein, Human is a recombinant human IL-36 alpha without any tag, which is produced in E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

IL-36 alpha/IL-1F6 Protein, Human Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-36 alpha (IL-1F6), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 alpha mediates inflammatory response. IL-36 alpha binds to IL-36R and activates NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases[1]. IL-36 alpha also binds to IL-1Rrp2 and recruit IL-1RAcP. IL-36 alpha activats the MAPK, Erk1/2 and JNK through IL-36R/IL-1RAcP[2]. IL-36 alpha/IL-1F6 Protein, Human is a recombinant human IL-36 alpha without any tag, which is produced in E. coli.

Background

IL-36 alpha, a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 alpha is expressed in monocytes, T/B-lymphocytes, spleen, bone-marrow tonsils, lymph nodes and skin[2]. IL-36 alpha is up-regulated in injured kidney. IL-36 alpha is associated with the development of renal pathologies, as well as hepatocellular carcinoma, and some inflammatory/immune diseases including colitis and psoriasis[3].
The sequence of amino acids in IL-36 alpha differs in different species. Human IL-36 alpha shares <55% aa sequence identity with mouse.
IL-36 alpha binds to IL-36R and activates NF-κB and MAPK signaling pathways, thereby mediating inflammatory response. But the activation requires N-terminal cleavage by neutrophil granule-derived proteases, such as cathepsin G, elastase and proteinase-3[1]. IL-36 alpha can also bind IL-1Rrp2 and recruit IL-1RAcP. IL-36 alpha activats the MAPK, Erk1/2 and JNK through IL-36R/IL-1RAcP[2].
IL-36 alpha is a pro-inflammatory factor. IL-36 alpha mediates inflammatory response through the activation of NF-κB and MAPK signaling pathway[1].

In Vitro

IL-36 alpha (human) (10 ng/mL, 48 h) stimulates the production of TNF-α and IL-1β in HCECs[4].
IL-36 alpha (human) (500 ng/mL, 48 h) induces maturation of human MDDCs[5].
IL-36 alpha (human) inhibits proliferation, migration, and invasion of both OV2008 and SKOV-3 cells[6].

Biological Activity

Measured by its ability to induce IL-8 secretion by A431 mouse embryonic fibroblast cells. The ED50 for this effect is ≤21.61 ng/mL. Corresponding to a specific activity is ≥4.63×104 U/mg.

  • Measured by its ability to induce IL-8 secretion by A431 mouse embryonic fibroblast cells. The ED50 for this effect is typically 21.61 ng/mL. Corresponding to a specific activity is 4.63×104 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9UHA7 (K6-F158)

Gene ID
Protein Length

Full Length of Mature Protein

Synonyms
IL-36 alpha; IL-36α; Interleukin-36 Alpha; FIL1 Epsilon; Interleukin-1 Epsilon; IL-1 Epsilon; Interleukin-1 Family Member 6; IL-1F6; IL36A; FIL1E; IL1E; IL1F6
AA Sequence

KIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF

Predicted Molecular Mass
17.1 kDa
Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, 0.02% Tween 20, pH 8.0 or 20 mM PB, 6% Trehalose, 5mM EDTA, 0.05% Tween 80, pH7.4..
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
References

IL-36 alpha/IL-1F6 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-36 alpha/IL-1F6 Protein, Human
Cat. No.:
HY-P70702
Quantity:
MCE Japan Authorized Agent: