IL-17B Protein, Human

IL-17B Proteinas, crucial in cellular signaling, induces the release of pro-inflammatory cytokines, TNF-α, and IL-1β from THP-1 monocytic cells. Its role in regulating immune responses and inflammatory processes underscores its potential significance in mediating crosstalk between immune cells, contributing to overall immune homeostasis. IL-17B Protein, Human is the recombinant human-derived IL-17B protein, expressed by E. coli , with tag free.

IL-17B protein plays a crucial role in cellular signaling by inducing the release of pro-inflammatory cytokines, specifically tumor necrosis factor alpha (TNF-α) and interleukin-1 beta (IL-1β), from the monocytic cell line THP-1. This activity highlights the protein's involvement in the regulation of immune responses and inflammatory processes, emphasizing its potential significance in mediating the crosstalk between immune cells and contributing to the overall immune homeostasis.

Measured by its ability to induce IL-8 secretion by HepG2 cells. The ED₅₀ for this effect is 1.169 μg/mL. Corresponding to a specific activity is 855.432 U/mg.

• 
  Measured by its ability to induce IL-8 secretion by HepG2 cells. The ED₅₀ for this effect is 1.169 μg/mL. Corresponding to a specific activity is 855.432 U/mg.

Human

E. coli

Tag Free

Q9UHF5 (Q21-F180)

27190  [NCBI]

Full length of Mature Protein

QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 3% trehalose, 0.1% Tween 20.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.