2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. Interleukin & Receptors
  5. IL-16
  6. IL-16 Protein, Mouse

IL-16 Protein, a cytokine, plays a significant role in immune regulation and inflammation. It modulates the activation and migration of various immune cells, such as T cells and monocytes. Understanding the functions of IL-16 Protein can aid in studying immune responses and developing targeted therapies for inflammatory and autoimmune diseases. IL-16 Protein, Mouse is the recombinant mouse-derived IL-16 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

IL-16 Protein, Mouse Featured Recommendations:

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-16 Protein, a cytokine, plays a significant role in immune regulation and inflammation. It modulates the activation and migration of various immune cells, such as T cells and monocytes. Understanding the functions of IL-16 Protein can aid in studying immune responses and developing targeted therapies for inflammatory and autoimmune diseases. IL-16 Protein, Mouse is the recombinant mouse-derived IL-16 protein, expressed by E. coli , with tag free.
Background

IL-16, a multifaceted protein, instigates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. It plays a pivotal role in priming CD4+ T-cells for responsiveness to interleukin-2 (IL-2) and interleukin-15 (IL-15), concurrently inducing the expression of the interleukin 2 receptor. Additionally, IL-16 serves as a ligand for CD4, fostering intricate interactions. Notably, isoform 1 of IL-16 is proposed to function as a scaffolding protein, providing a structural anchor for ion channels within the cellular membrane.
Species

Mouse
Source

E. coli
Tag

Tag Free
Accession

O54824 (S1205-S1322)
Gene ID
Molecular Construction
N-term
IL-16 (S1205-S1322)
Accession # O54824
C-term
Protein Length

Full Length of Mature Protein
Synonyms
Il16; Pro-interleukin-16Interleukin-16; IL-16; Lymphocyte chemoattractant factor; LCF;
AA Sequence

SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS

Predicted Molecular Mass
12.2 kDa
Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
Purity

Greater than 95% as determined by reducing SDS-PAGE
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

IL-16 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-16 Protein, Mouse
Cat. No.:
HY-P71872
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.