1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-16
  5. IL-16 Protein, Mouse

IL-16 Protein, a cytokine, plays a significant role in immune regulation and inflammation. It modulates the activation and migration of various immune cells, such as T cells and monocytes. Understanding the functions of IL-16 Protein can aid in studying immune responses and developing targeted therapies for inflammatory and autoimmune diseases. IL-16 Protein, Mouse is the recombinant mouse-derived IL-16 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-16 Protein, a cytokine, plays a significant role in immune regulation and inflammation. It modulates the activation and migration of various immune cells, such as T cells and monocytes. Understanding the functions of IL-16 Protein can aid in studying immune responses and developing targeted therapies for inflammatory and autoimmune diseases. IL-16 Protein, Mouse is the recombinant mouse-derived IL-16 protein, expressed by E. coli , with tag free.

Background

IL-16, a multifaceted protein, instigates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. It plays a pivotal role in priming CD4+ T-cells for responsiveness to interleukin-2 (IL-2) and interleukin-15 (IL-15), concurrently inducing the expression of the interleukin 2 receptor. Additionally, IL-16 serves as a ligand for CD4, fostering intricate interactions. Notably, isoform 1 of IL-16 is proposed to function as a scaffolding protein, providing a structural anchor for ion channels within the cellular membrane.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse CD4 (HY-P72904) at 2 μg/mL (100 μL/well) can bind Biotinylated Mouse IL-16. The ED50 for this effect is 153.1 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Mouse CD4 (HY-P72904) at 2 μg/mL (100 μL/well) can bind Biotinylated Mouse IL-16. The ED50 for this effect is 153.1 ng/mL.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

O54824 (S1205-S1322)

Gene ID
Molecular Construction
N-term
IL-16 (S1205-S1322)
Accession # O54824
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Il16; Pro-interleukin-16Interleukin-16; IL-16; Lymphocyte chemoattractant factor; LCF;
AA Sequence

SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS

Predicted Molecular Mass
12.2 kDa
Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE..
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-16 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-16 Protein, Mouse
Cat. No.:
HY-P71872
Quantity:
MCE Japan Authorized Agent: