1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-gamma Receptor
  5. IFN-gamma R1
  6. IFN-gamma R1/CD119 Protein, Human (HEK293, His-Flag)

IFN-gamma R1/CD119 Protein, Human (HEK293, His-Flag)

Cat. No.: HY-P700611
Handling Instructions Technical Support

IFN-γ R1/CD119 is an important receptor subunit of interferon γ/INFG that activates effector immune cells and enhances antigen presentation, contributing to antibacterial, antiviral, and antitumor responses. It cooperates with IFNGR2 to form a functional receptor. IFN-gamma R1/CD119 Protein, Human (HEK293, His-Flag) is the recombinant human-derived IFN-gamma R1/CD119 protein, expressed by HEK293 , with C-6*His, C-Flag labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-γ R1/CD119 is an important receptor subunit of interferon γ/INFG that activates effector immune cells and enhances antigen presentation, contributing to antibacterial, antiviral, and antitumor responses. It cooperates with IFNGR2 to form a functional receptor. IFN-gamma R1/CD119 Protein, Human (HEK293, His-Flag) is the recombinant human-derived IFN-gamma R1/CD119 protein, expressed by HEK293 , with C-6*His, C-Flag labeled tag.

Background

IFN-gamma R1 (CD119) serves as the receptor subunit for interferon gamma (IFNG), playing pivotal roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Teaming up with the transmembrane accessory factor IFNGR2, IFNGR1 forms a functional receptor complex. Upon IFNG binding, the intracellular domain of IFNGR1 undergoes conformational changes, allowing the association of downstream signaling components, including JAK1 and JAK2. Activated JAK1 phosphorylates IFNGR1, creating a docking site for STAT1. Subsequent phosphorylation of STAT1 leads to dimerization, translocation to the nucleus, and stimulation of target gene transcription. IFNGR1 also facilitates the activation of STAT3, albeit to a lesser extent. Furthermore, the phosphorylated IFNGR1 domain provides a docking site for SOCS1, which regulates the JAK-STAT pathway by competing with STAT1 for binding to IFNGR1. IFNGR1 can exist as a monomer and forms a heterodimer with IFNGR2 to constitute the IFNG receptor complex. The receptor also interacts with JAK1, STAT1, and SOCS1, orchestrating a complex signaling network in response to IFNG.

Species

Human

Source

HEK293

Tag

C-6*His;C-Flag

Accession

P15260-1 (E18-G245)

Gene ID
Molecular Construction
N-term
IFNGR1 (E18-G245)
Accession # P15260-1
6*His-Flag
C-term
Protein Length

Extracellular Domain

Synonyms
Interferon gamma receptor 1; IFN-gamma-R1; IFN-gamma-R-alpha; CD119; Ifngr1
AA Sequence

EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG

Predicted Molecular Mass
29 kDa
Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IFN-gamma R1/CD119 Protein, Human (HEK293, His-Flag) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-gamma R1/CD119 Protein, Human (HEK293, His-Flag)
Cat. No.:
HY-P700611
Quantity:
MCE Japan Authorized Agent: