1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. Interferon & Receptors
  4. IFN-γ
  5. IFN-gamma Protein, Human (Biotinylated, HEK293, His-Avi)

IFN-gamma Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78140
Handling Instructions Technical Support

IFN-gamma Protein is a dimeric soluble cytokine. It exerts antibacterial, antiviral and antitumor effects through JAK-STAT, mTOR, MAPK and PI3K/AKT signaling pathways. IFN-gamma Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived IFN-gamma protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-gamma Protein is a dimeric soluble cytokine. It exerts antibacterial, antiviral and antitumor effects through JAK-STAT, mTOR, MAPK and PI3K/AKT signaling pathways. IFN-gamma Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived IFN-gamma protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

IFN-gamma is a dimeric soluble cytokine that is the only member of type II interferon IFN-gamma is produced by immune cells T cells and NK cells and plays an important role in antimicrobial, antiviral and anti-tumor responses by activating effector immune cells and enhancing antigen presentation. IFN-gamma influences gene regulation by interacting with its receptor IFNGR1 through the JAK-STAT pathway, and can also trigger mTOR, MAPK, and PI3K/AKT signaling pathways. IFN-gamma plays a role in the Class I antigen presentation pathway by inducing the substitution of the catalytic proteasome subunit for the immune proteasome subunit. IFN-gamma upregulates the MHC II complex on the cell surface by promoting the expression of several key molecules such as pepsin B/CTSB, H/CTSH, and L/CTSL. IFN-gamma is involved in the regulation of hematopoietic stem cells under developmental and homeostasis conditions by influencing the development, quiescence and differentiation of hematopoietic stem cells[1][2][3][4][5].

Biological Activity

1. Immobilized Biotinylated Human IFN gamma at 1 μg/mL (100 μL/Well) on the plate. Dose response curve for Human IFNGR1 hFc with the EC50< 35.7 ng/mL determined by ELISA.
2. Immobilized Human IFNGR1, hFc Tag at 2 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Human IFN gamma, His Tag with the EC50 ≤ 0.16 μg/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-Avi;C-His

Accession

P01579 (Q24-G161)

Gene ID
Molecular Construction
N-term
IFN-gamma (Q24-G161)
Accession # P01579
His-Avi
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interferon-gamma; Interferon-γ; interferon; gamma; IFG; IFI; IFN gamma
AA Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Molecular Weight

25-40 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IFN-gamma Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-gamma Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78140
Quantity:
MCE Japan Authorized Agent: