1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-alpha
  5. IFN-alpha 13
  6. IFN-alpha 1b/IFNA13 Protein, Human

IFN-alpha 1/13 (IFNA1), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 1 involves in the activation of JAK1 and TYK2 pathway, exerts function by inhibiting viral replication as well as modulating immune response. IFN-alpha 1b/IFNA13 Protein, Human contains 166 a.a. (C24-D189, A137V), produced in E. coli cells with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-alpha 1/13 (IFNA1), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 1 involves in the activation of JAK1 and TYK2 pathway[4], exerts function by inhibiting viral replication as well as modulating immune response[3]. IFN-alpha 1b/IFNA13 Protein, Human contains 166 a.a. (C24-D189, A137V), produced in E. coli cells with tag free.

Background

Interferon alpha-1/13 is produced by the macrophages, belongs to the alpha/beta interferon (IFN) family, a family of cytokines induced by viral infection and are primarily involved in antiviral defense of the cells[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[2].
Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia[3].
IFN-alpha13 exhibits acid-stable antiviral activity against Theiler's virus, Mengo virus, and vesicular stomatitis virus. Firstly, it is transcribed constitutively, independent of viral infection and of interferon regulatory factor-7 induction. Secondly, it contains two N-glycosylation sites, in contrast to other murine IFN-alpha subtypes that contain either one or no N-glycosylation site[4]. As for a wildly use of IFN in animal model, the sequence of amino acids in IFNA13 protein of human is very different from mouse (64.55%)

Biological Activity

The specific activity determined by an anti-viral assay is no less than 1.0 × 108 IU/mg.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P01562 (C24-E189, A137V)

Gene ID

3439  [NCBI]/3447  [NCBI]

Molecular Construction
N-term
IFNA1 (C24-E189, A137V)
Accession # P01562
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interferon alpha-1/13; IFN-alpha-1/13; LeIF D; IFNA1; IFNA13
AA Sequence

CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Molecular Weight

Approximately 19.5 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, containing 4% mannitol and 1% HSA.

Endotoxin Level

<1 EU/μg; determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IFN-alpha 1b/IFNA13 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-alpha 1b/IFNA13 Protein, Human
Cat. No.:
HY-P72796
Quantity:
MCE Japan Authorized Agent: