1. Recombinant Proteins
  2. Cytokines and Growth Factors GMP-grade Proteins
  3. Interleukin & Receptors
  4. IL-15
  5. GMP IL-15 Protein, Human

The IL-15 protein is a cytokine that plays a key role in inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. GMP IL-15 Protein, Human is the recombinant human-derived IL-15 protein, expressed by E. coli , with tag free.

GMP-grade recombinant proteins are produced under independent QA supervision, as well as quality records and full traceability.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE GMP IL-15 Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

The IL-15 protein is a cytokine that plays a key role in inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. GMP IL-15 Protein, Human is the recombinant human-derived IL-15 protein, expressed by E. coli , with tag free.

Background

IL-15 Protein assumes a pivotal role in orchestrating inflammatory and protective immune responses against microbial invaders and parasites, modulating immune cells across both the innate and adaptive immune systems. This cytokine stimulates the proliferation of natural killer cells, T-cells, and B-cells, while also promoting the secretion of various cytokines. Notably, IL-15, unlike most cytokines, is expressed on the surface of IL-15-producing cells in association with its high-affinity receptor IL15RA, delivering signals to target cells expressing IL2RB and IL2RG receptor subunits. Upon binding to its receptor, IL-15 triggers the phosphorylation of JAK1 and JAK3, recruiting and subsequently phosphorylating signal transducer and activator of transcription-3/STAT3 and STAT5. In monocytes, IL-15 induces the production of IL8 and monocyte chemotactic protein 1/CCL2, attracting neutrophils and monocytes to infection sites. Additionally, in mast cells, IL-15 induces rapid tyrosine phosphorylation of STAT6, exerting control over mast cell survival and the release of cytokines such as IL4.

In Vitro

GMP IL-15 Protein, Human (0-100 ng/mL, 24 h) induces the IL-5 production in human derfII-specific T cell clone and the proliferation of T cell clones[1].

In Vivo

GMP IL-15 Protein, Human (200 μg/day, ip, once daily for 4 days) promotes the proliferation and survival of NK cells in peripheral blood, spleen and bone marrow of mice[2].

Biological Activity

Measured in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells. The specific activity of Recombinant human IL-15 is ≥ 1.0 × 107 IU/mg. which is calibrated against human IL-15 WHO International Standard.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P40933-1 (N49-S162)

Gene ID
Molecular Construction
N-term
IL-15 (N49-S162)
Accession # P40933-1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Interleukin-15; IL-15; IL15
AA Sequence

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Molecular Weight

Approximately 12.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.0.

Endotoxin Level

<0.01 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

GMP IL-15 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GMP IL-15 Protein, Human
Cat. No.:
HY-P70776G
Quantity:
MCE Japan Authorized Agent: