1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. Galectin-9
  5. Galectin-9/LGALS9 Protein, Human (GST)

Galectin-9/LGALS9 Protein acts as an eosinophil chemoattractant, recruiting and migrating eosinophils, key immune cells in inflammatory responses. It also serves as an angiogenesis inhibitor, regulating blood vessel formation and impacting vascular processes. Functioning as a regulatory modulator, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways. Galectin-9/LGALS9 Protein, Human (GST) is the recombinant human-derived Galectin-9/LGALS9 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Galectin-9/LGALS9 Protein acts as an eosinophil chemoattractant, recruiting and migrating eosinophils, key immune cells in inflammatory responses. It also serves as an angiogenesis inhibitor, regulating blood vessel formation and impacting vascular processes. Functioning as a regulatory modulator, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways. Galectin-9/LGALS9 Protein, Human (GST) is the recombinant human-derived Galectin-9/LGALS9 protein, expressed by E. coli , with N-GST labeled tag.

Background

Galectin-9/LGALS9 protein functions as an eosinophil chemoattractant, actively participating in the recruitment and migration of eosinophils, crucial immune cells involved in inflammatory responses. Moreover, it serves as an angiogenesis inhibitor, contributing to the regulation of blood vessel formation and impacting vascular processes. In its role as a regulatory modulator of immune responses, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways (By similarity).

Species

Human

Source

E. coli

Tag

N-GST

Accession

O00182-2 (M1-T323)

Gene ID
Molecular Construction
N-term
GST
Galectin-9/LGALS9 (M1-T323)
Accession # O00182-2
C-term
Synonyms
Galectin-9; Gal-9; Ecalectin; Tumor antigen HOM-HD-21; LGALS9; Gal-9delta5
AA Sequence

MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Molecular Weight

Approximately 60.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 1 M PBS, 100 mM GSH, 15% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Galectin-9/LGALS9 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Galectin-9/LGALS9 Protein, Human (GST)
Cat. No.:
HY-P70696
Quantity:
MCE Japan Authorized Agent: