1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. FXN Protein, Rat

FXN protein activates persulfide transfer in the ISC assembly complex, promoting sulfur transfer and leading to persulfide and sulfide release. It binds ferrous ions, initiates [2Fe-2S] cluster synthesis, and transfers it to chaperone proteins. FXN Protein, Rat is the recombinant rat-derived FXN protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FXN protein activates persulfide transfer in the ISC assembly complex, promoting sulfur transfer and leading to persulfide and sulfide release. It binds ferrous ions, initiates [2Fe-2S] cluster synthesis, and transfers it to chaperone proteins. FXN Protein, Rat is the recombinant rat-derived FXN protein, expressed by E. coli , with tag free.

Background

FXN Protein acts as an activator in the persulfide transfer process within the core iron-sulfur cluster (ISC) assembly complex, essential for [2Fe-2S] cluster assembly. It facilitates sulfur transfer from NFS1 persulfide intermediate to ISCU and small thiols like L-cysteine and glutathione, leading to persulfuration and sulfide release. During [2Fe-2S] cluster assembly, FXN binds ferrous ion and is released upon the addition of L-cysteine and reduced FDX2. The ISC assembly complex, comprising FXN, NFS1, LYRM4, NDUFAB1, and FDX2, initiates de novo synthesis of [2Fe-2S] clusters, transferring them to chaperone proteins like HSCB, HSPA9, and GLRX5. FXN may protect against iron-catalyzed oxidative stress, displaying ferroxidase activity in its oligomeric form. It might function as an iron chaperone, safeguarding aconitase [4Fe-4S]2+ clusters, participating in mitochondrial heme biosynthesis, and modulating the RNA-binding activity of ACO1. Additionally, FXN could contribute to cytoplasmic iron-sulfur protein biogenesis, oxidative stress resistance, and overall cell survival.

Species

Rat

Source

E. coli

Tag

Tag Free

Accession

D3ZYW7 (L41-T208)

Gene ID
Molecular Construction
N-term
FXN (L41-T208)
Accession # D3ZYW7
C-term
Synonyms
Frataxin; mitochondrial; Fxn; EC 1.16.3.1; Frataxin intermediate form; Frataxin mature form
AA Sequence

LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT

Molecular Weight

Approximately 18.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FXN Protein, Rat Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FXN Protein, Rat
Cat. No.:
HY-P72200
Quantity:
MCE Japan Authorized Agent: