1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Frizzled
  5. Frizzled-7
  6. Frizzled-7 Protein, Human (HEK293, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (HEK293, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (HEK293, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The Frizzled-7 (FZD7) Protein, a member of the 'frizzled' gene family, encodes a 7-transmembrane domain receptor for Wnt signaling proteins. The FZD7 protein structure includes an N-terminal signal sequence, a cysteine-rich extracellular domain with 10 cysteine residues characteristic of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail featuring a PDZ domain-binding motif. The expression of the FZD7 gene is implicated in potentially downregulating APC function and enhancing beta-catenin-mediated signals, particularly observed in poorly differentiated human esophageal carcinomas. This highlights FZD7's role in modulating critical cellular signaling pathways, particularly in the context of cancer progression.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

O75084/NP_003498 (Q33-L185)

Gene ID

8324

Molecular Construction
N-term
Frizzled-7 (Q33-L185)
Accession # NP_003498
hFc
C-term
Protein Length

Partial

Synonyms
Frizzled Class Receptor 7; FzE3; Frizzled 7, Seven Transmembrane Spanning Receptor; Frizzled Family Receptor 7; Frizzled-7
AA Sequence

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Weight

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Frizzled-7 Protein, Human (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Frizzled-7 Protein, Human (HEK293, hFc)
Cat. No.:
HY-P705549
Quantity:
MCE Japan Authorized Agent: