1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. EGF
  5. EGF Protein, Mouse

EGF Protein, Mouse is a growth factor that stimulates the proliferation of the epidermis and several epithelial tissues.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

EGF Protein, Mouse is a growth factor that stimulates the proliferation of the epidermis and several epithelial tissues.

Background

Epidermal growth factor (EGF) binds to epidermal growth factor receptor and stimulates an intracellular signal transduction cascade, leading to activation of genes that regulate cell proliferation, angiogenesis, motility, and metastasis[1]. Epidermal growth factor (EGF) is initially synthesized as a large precursor of 1217 amino acids that is glycosylated and can be secreted by cells. Epidermal growth factor (EGF) mRNA and protein are expressed in a number of adult tissues, especially in epithelial cells in the gastrointestinal tract. Predominant sites of synthesis of this peptide are the submandibular glands, the Brunner glands in the small intestine and the kidney[2].

Biological Activity

The ED50 is <0.1 ng/mL as measured by BALB/c 3T3 cells, corresponding to a specific activity of >1.0 × 107 units/mg.

  • Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 60.44 pg/mL, corresponding to a specific activity is 1.65×107 units/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P01132 (N977-R1029)

Gene ID
Molecular Construction
N-term
EGF (N977-R1029)
Accession # P01132
C-term
Protein Length

Full Length of EGF

Synonyms
rMuEGF; Pro-epidermal growth factor; Urogastrone
AA Sequence

NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Weight

Approximately 8 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

EGF Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EGF Protein, Mouse
Cat. No.:
HY-P7067
Quantity:
MCE Japan Authorized Agent: