1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. EGF
  5. EGF Protein, Mouse (His)

EGF is a polypeptide. EGF is originally isolated and purified from the submandibular gland of adult male mice. EGF binds to the epidermal growth factor receptor (EGFR) on the cell surface and activates a series of signal transduction pathways such as the c-Src/STAT3 signaling pathway, thereby stimulating cell proliferation. EGF has activities such as inducing cell morphological changes and activating protein kinases. EGF Protein, Mouse (His) is a recombinant EGF protein expressed by E. coli with a C-6*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

EGF is a polypeptide. EGF is originally isolated and purified from the submandibular gland of adult male mice. EGF binds to the epidermal growth factor receptor (EGFR) on the cell surface and activates a series of signal transduction pathways such as the c-Src/STAT3 signaling pathway, thereby stimulating cell proliferation. EGF has activities such as inducing cell morphological changes and activating protein kinases. EGF Protein, Mouse (His) is a recombinant EGF protein expressed by E. coli with a C-6*His tag.

Background

EGF Protein belongs to the epidermal growth factor family. EGF is a polypeptide that was originally isolated and purified from the submandibular gland of adult male mice[1]. EGF binds to the epidermal growth factor receptor (EGFR) on the cell surface and activates a series of signal transduction pathways such as the c-Src/STAT3 signaling pathway, thereby stimulating cell proliferation[1]. EGF has activities such as inducing cell morphological changes and activating protein kinases[5]. EGF is expressed in a variety of tissues, including testis, breast, ovary, etc[1][2][4]. Mouse EGF is highly similar to EGF from other species such as human in terms of amino acid sequence[5]. Mouse EGF is a single-chain polypeptide with 53 amino acid residues and a molecular weight of approximately 6045 Da[5].

Biological Activity

Measured by its ability to inhibits the proliferation of human epithelial A431 cells.The ED50 for this effect is <20 ng/mL.

Species

Mouse

Source

E. coli

Tag

C-6*His

Accession

P01132 (N977-R1029)

Gene ID
Molecular Construction
N-term
EGF (N977-R1029)
Accession # P01132
6*His
C-term
Protein Length

Full Length of EGF

Synonyms
Pro-epidermal growth factor; Epidermal growth factor; EGF
AA Sequence

NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Weight

9-14 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

EGF Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EGF Protein, Mouse (His)
Cat. No.:
HY-P70590
Quantity:
MCE Japan Authorized Agent: