1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. EGF
  5. EGF Protein, Rat

EGF Protein, Rat is a potent epidermal growth factor, promotes epithelial proliferation and migration, and increases epithelial wound closure and shortens healing time.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg Get quote
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

EGF Protein, Rat is a potent epidermal growth factor, promotes epithelial proliferation and migration, and increases epithelial wound closure and shortens healing time.

Background

Epidermal Growth Factor is secreted by epithelial cells, promotes epithelial proliferation and migration in a variety of tissues, and increases epithelial wound closure and shortens healing time[1]. Epidermal Growth Factor plays a key role in skin development and homeostasis, shows a protective function in the epidermal barrier. Epidermal Growth Factor also displays an immunomodulatory activity in the inflamed skin tissue[2].

Biological Activity

Measured in a cell proliferation assay using BALB/c 3T3 mouse fibroblasts. The ED50 for this effect is 78.34 pg/mL, corresponding to a specific activity is 1.28×107 units/mg.

  • Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 this effect is 199.3 pg/mL, corresponding to a specific activity is 5.02×106 U/mg.
Species

Rat

Source

E. coli

Tag

Tag Free

Accession

P07522/NP_036974.1 (N974-R1026)

Gene ID
Molecular Construction
N-term
EGF (N974-R1026)
Accession # P07522
C-term
Protein Length

Partial

Synonyms
rRtEGF; Pro-epidermal growth factor; Urogastrone
AA Sequence

NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR

Predicted Molecular Mass
6.3 kDa
Molecular Weight

Approximately 6-9 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4 or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

EGF Protein, Rat Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EGF Protein, Rat
Cat. No.:
HY-P7092
Quantity:
MCE Japan Authorized Agent: