1. Recombinant Proteins
  2. Others
  3. Dermatopontin/DPT Protein, Human (HEK293, Fc, His)

Dermatopontin/DPT Protein, Human (HEK293, Fc, His)

Cat. No.: HY-P72667
Handling Instructions Technical Support

Dermatopontin/DPT Protein facilitates adhesion by binding to integrins on the cell surface. It acts as a conduit for communication between dermal fibroblast cells and the extracellular matrix. Furthermore, it enhances TGFB1 activity, inhibits cell proliferation, promotes collagen fibril formation, and stabilizes them at low temperatures. DPT Protein interacts with TGFB1, DCN, and collagen. Dermatopontin/DPT Protein, Human (HEK293, Fc, His) is the recombinant human-derived Dermatopontin/DPT protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Dermatopontin/DPT Protein facilitates adhesion by binding to integrins on the cell surface. It acts as a conduit for communication between dermal fibroblast cells and the extracellular matrix. Furthermore, it enhances TGFB1 activity, inhibits cell proliferation, promotes collagen fibril formation, and stabilizes them at low temperatures. DPT Protein interacts with TGFB1, DCN, and collagen. Dermatopontin/DPT Protein, Human (HEK293, Fc, His) is the recombinant human-derived Dermatopontin/DPT protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

Background

The Dermatopontin/DPT protein is believed to facilitate adhesion through its binding to integrins on the cell surface. It may act as a conduit for communication between dermal fibroblast cells and their surrounding extracellular matrix. Additionally, it enhances the activity of TGFB1, inhibits cell proliferation, promotes the formation of collagen fibrils, and helps stabilize them against dissociation at low temperatures. The protein interacts with TGFB1, DCN, and collagen.

Species

Human

Source

HEK293

Tag

C-hFc;C-6*His

Accession

Q07507 (Q19-V201)

Gene ID
Molecular Construction
N-term
DPT (Q19-V201)
Accession # Q07507
hFc-6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Dermatopontin; TRAMP; DPT
AA Sequence

QYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV

Molecular Weight

50-60 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 4% Sucrose, 4% mannitol, 0.02% Tween80, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Dermatopontin/DPT Protein, Human (HEK293, Fc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Dermatopontin/DPT Protein, Human (HEK293, Fc, His)
Cat. No.:
HY-P72667
Quantity:
MCE Japan Authorized Agent: