Fractalkine/CX3CL1 Protein, Mouse

The Fractalkine/CX3CL1 protein is a multifunctional chemokine that binds to CX3CR1 and the integrins ITGAV:ITGB3 and ITGA4:ITGB1. It regulates immune responses, inflammation, cell adhesion, and chemotaxis. Fractalkine/CX3CL1 Protein, Mouse is the recombinant mouse-derived Fractalkine/CX3CL1 protein, expressed by E. coli , with tag free.

Fractalkine/CX3CL1 protein functions as a versatile chemokine, serving as a ligand for both CX3CR1 and integrins ITGAV:ITGB3 and ITGA4:ITGB1. The CX3CR1-CX3CL1 signaling axis manifests distinct functions in various tissue compartments, including immune response modulation, inflammation regulation, cell adhesion, and chemotaxis. In the context of endothelial interactions, Fractalkine/CX3CL1 plays a pivotal role in regulating leukocyte adhesion and migration processes. Notably, it can activate integrins in a CX3CR1-dependent or CX3CR1-independent manner, binding to both the classical ligand-binding site (site 1) and a distinct site (site 2) on integrins. In the presence of CX3CR1, it activates integrins directly through site 1, while in the absence of CX3CR1, it binds to site 2, enhancing the binding of other integrin ligands to site 1. Additionally, the soluble form of Fractalkine/CX3CL1 demonstrates chemotactic properties for T-cells and monocytes, albeit not for neutrophils.

Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with mouse CX3CR1. The ED₅₀ for this effect is 15.44 ng/mL, corresponding to a specific activity is 6.48×10^4 U/mg.

• 
  Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with mouse CX3CR1. The ED₅₀ for this effect is 15.44 ng/mL, corresponding to a specific activity is 6.48×10⁴ U/mg.

Mouse

E. coli

Tag Free

O35188 (Q25-G100)

20312  [NCBI]

Partial

QHLGMTKCEIMCGKMTSRIPVALLIRYQLNQESCGKRAIVLETTQHRRFCADPKEKWVQDAMKHLDHQAAALTKNG

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

• 
  Greater than 95% as determined by reducing SDS-PAGE..

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.