1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. CTRL-1 Protein, Human (HEK293, His)

CTRL-1 protein is an important member of the peptidase S1 family. As a serine protease, it catalyzes the hydrolysis of peptide bonds. CTRL-1 may share conserved features with related proteins that play important roles in cellular processes related to proteolysis and regulation of biological pathways. CTRL-1 Protein, Human (HEK293, His) is the recombinant human-derived CTRL-1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CTRL-1 protein is an important member of the peptidase S1 family. As a serine protease, it catalyzes the hydrolysis of peptide bonds. CTRL-1 may share conserved features with related proteins that play important roles in cellular processes related to proteolysis and regulation of biological pathways. CTRL-1 Protein, Human (HEK293, His) is the recombinant human-derived CTRL-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The CTRL-1 Protein is an essential member of the peptidase S1 family, signifying its crucial role as a serine protease enzyme. As part of this enzyme family, CTRL-1 likely shares conserved structural and functional features with related proteins, indicating its involvement in catalyzing the hydrolysis of peptide bonds. The membership in the peptidase S1 family underscores its significance in cellular processes related to proteolysis and the regulation of various biological pathways. The study of CTRL-1 provides insights into its specific enzymatic functions within the context of the peptidase S1 family, offering potential applications in therapeutic interventions and a deeper understanding of its broader impact on cellular processes involved in protein metabolism. Further exploration of CTRL-1's role promises to enhance our comprehension of its contributions to normal physiology and pathological conditions.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P40313 (C19-N264)

Gene ID
Molecular Construction
N-term
CTRL-1 (C19-N264)
Accession # P40313
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuChymotrypsin-like protease CTRL-1/CTRL-1, His; Chymotrypsin-Like Protease CTRL-1; CTRL; CTRL1
AA Sequence

CGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN

Molecular Weight

28-38 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 10% glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

CTRL-1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CTRL-1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70033
Quantity:
MCE Japan Authorized Agent: