1. Recombinant Proteins
  2. Others
  3. Collectrin/TMEM27 Protein, Human (HEK293, Fc)

Collectrin/TMEM27 Protein, Human (HEK293, Fc)

Cat. No.: HY-P77246
Handling Instructions Technical Support

Collectrin, also known as TMEM27, plays a key role in amino acid transport by binding to SLC6A18 and SLC6A19 and regulating their surface trafficking and amino acid transporter activity. Suggested to facilitate the trafficking of SLC3A1 and SLC7A9 to the renal cortical cell membrane. Collectrin/TMEM27 Protein, Human (HEK293, Fc) is the recombinant human-derived Collectrin/TMEM27 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Collectrin, also known as TMEM27, plays a key role in amino acid transport by binding to SLC6A18 and SLC6A19 and regulating their surface trafficking and amino acid transporter activity. Suggested to facilitate the trafficking of SLC3A1 and SLC7A9 to the renal cortical cell membrane. Collectrin/TMEM27 Protein, Human (HEK293, Fc) is the recombinant human-derived Collectrin/TMEM27 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The Collectrin protein, also known as TMEM27, plays a pivotal role in amino acid transport by serving as a binding partner for amino acid transporters SLC6A18 and SLC6A19, thereby regulating their trafficking on the cell surface and influencing their amino acid transporter activity. It is proposed to contribute to the trafficking of amino acid transporters SLC3A1 and SLC7A9 to the renal cortical cell membrane. Additionally, Collectrin acts as a regulator of SNARE complex function and functions as a stimulator of beta cell replication. Structurally, Collectrin exists both as a monomer and a homodimer, with the dimerization preventing CLTRN cleavage by BACE2. In terms of molecular interactions, Collectrin interacts with SLC6A18 and SLC6A19, intricately regulating their membrane trafficking and amino acid transporter activities, while also forming an interaction with SNAPIN. These findings underscore Collectrin's multifaceted involvement in amino acid transport and cellular processes, highlighting its crucial role in maintaining proper cellular function.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q9HBJ8 (E15-P141)

Gene ID
Molecular Construction
N-term
Collectrin (E15-P141)
Accession # Q9HBJ8
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Collectrin; Transmembrane protein 27; CLTRN; TMEM27
AA Sequence

ELCQPGAENAFKVRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLNDQTLEFLKIPSTLAPPMDPSVP

Molecular Weight

53-57 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Collectrin/TMEM27 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Collectrin/TMEM27 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77246
Quantity:
MCE Japan Authorized Agent: