1. Recombinant Proteins
  2. Enzymes & Regulators
  3. CLPS Protein, Human (sf9, His)

CLPS or colipase is an important cofactor for pancreatic lipase that helps anchor it at the lipid-water interface. In the absence of colipase, pancreatic lipase is easily washed away by bile salts, which inhibit the enzyme. CLPS Protein, Human (sf9, His) is the recombinant human-derived CLPS protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CLPS or colipase is an important cofactor for pancreatic lipase that helps anchor it at the lipid-water interface. In the absence of colipase, pancreatic lipase is easily washed away by bile salts, which inhibit the enzyme. CLPS Protein, Human (sf9, His) is the recombinant human-derived CLPS protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

Colipase (CLPS) is a vital cofactor for pancreatic lipase, facilitating its anchoring to the lipid-water interface. This interaction is crucial for the enzyme's stability and effectiveness in lipid digestion. In the absence of colipase, pancreatic lipase is prone to being washed away by bile salts, which exert an inhibitory effect on the lipase. Colipase's role in enhancing lipase activity underscores its significance in efficient lipid hydrolysis within the digestive system. Furthermore, the biological activity of enterostatin as a satiety signal suggests a potential role for colipase in the regulation of appetite and food intake, further highlighting its multifaceted functions in digestive processes and metabolic regulation (

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized CLPS at 10 μg/mL(100 μL/well) can bind biotinylated PNLIP. The ED50 for this effect is 1.183 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized CLPS at 10 μg/mL(100 μL/well) can bind biotinylated PNLIP (HY-P75978). The ED50 for this effect is 1.183 μg/mL.
Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

P04118 (A18-Q112)

Gene ID
Molecular Construction
N-term
CLPS (A18-Q112)
Accession # P04118
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Colipase; CLPS
AA Sequence

APGPRGIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ

Molecular Weight

Approximately 12 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 637 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4, 10% glycerol, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

CLPS Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLPS Protein, Human (sf9, His)
Cat. No.:
HY-P72933
Quantity:
MCE Japan Authorized Agent: