1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. CDO1/Cysteine dioxygenase type 1 Protein, Human (His)

CDO1/Cysteine dioxygenase type 1 Protein, Human (His)

Cat. No.: HY-P70066
Handling Instructions Technical Support

Cysteine dioxygenase (CDO1) plays a crucial role in cellular metabolism by catalyzing the oxidation of cysteine to cysteine sulfenic acid, a key step involving the addition of molecular dioxygen . This enzymatic process underlies cysteine catabolism and helps regulate sulfur amino acid metabolism. CDO1/Cysteine dioxygenase type 1 Protein, Human (His) is the recombinant human-derived CDO1/Cysteine dioxygenase type 1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE CDO1/Cysteine dioxygenase type 1 Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cysteine dioxygenase (CDO1) plays a crucial role in cellular metabolism by catalyzing the oxidation of cysteine to cysteine sulfenic acid, a key step involving the addition of molecular dioxygen . This enzymatic process underlies cysteine catabolism and helps regulate sulfur amino acid metabolism. CDO1/Cysteine dioxygenase type 1 Protein, Human (His) is the recombinant human-derived CDO1/Cysteine dioxygenase type 1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

Cysteine dioxygenase type 1 (CDO1) is a crucial enzyme that catalyzes the oxidation of cysteine to cysteine sulfinic acid through the addition of molecular dioxygen. This enzymatic process represents a key step in the catabolism of cysteine, regulating the conversion of this amino acid to its sulfinic acid derivative. The activity of CDO1 is significant for maintaining cellular homeostasis and contributing to sulfur metabolism. By facilitating the oxidation of cysteine, CDO1 plays a pivotal role in regulating the levels of this amino acid and its downstream metabolites, influencing various physiological processes. This enzyme's involvement in cysteine catabolism underscores its importance in cellular sulfur metabolism and highlights its potential impact on redox balance and other metabolic pathways.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q16878 (M1-N200)

Gene ID
Molecular Construction
N-term
6*His
CDO1 (M1-N200)
Accession # Q16878
C-term
Protein Length

Full Length

Synonyms
rHuCysteine dioxygenase type 1/CDO1, His; Cysteine Dioxygenase Type 1; Cysteine Dioxygenase Type I; CDO; CDO-I; CDO1
AA Sequence

MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN

Molecular Weight

20-28 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 1 mM DTT, 10% Glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

CDO1/Cysteine dioxygenase type 1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CDO1/Cysteine dioxygenase type 1 Protein, Human (His)
Cat. No.:
HY-P70066
Quantity:
MCE Japan Authorized Agent: